Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD99, Rat (HEK293, Fc)

CD99 protein is a member of the CD99 family and plays a key role in several important cellular processes such as immune response, cell adhesion and migration. It exerts a major influence on lymphocyte trafficking and is involved in the regulation of immune cell interactions. CD99 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD99 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CD99 Protein, Rat (HEK293, Fc), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd99-protein-rat-hek293-fc.html

Purity

95.00

Smiles

DGDFRLDDALEDTDKKPTPKPPTPKKPSSGDFDLEEALTGGADEDPRRPGSRPKPDPKPPGPPRDSGGISDRDLEDVAGHGGRGGGAGDRGTDGAESEGQPQG

Molecular Formula

652929 (Gene_ID) B4F7A5 (D25-G127) (Accession)

Molecular Weight

Approximately 48 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-CK1 gamma 2 Antibody
DL90283A-01 50 µL

Rabbit anti-CK1 gamma 2 Antibody

Sign In for Pricing
View Details
Rabbit anti-CK1 gamma 2 Antibody
DL90283A-02 100 µL

Rabbit anti-CK1 gamma 2 Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Integrin alpha 6/CD49f Antibody (CL6957)
NBP2-76523 100 µL

Mouse Monoclonal Integrin alpha 6/CD49f Antibody (CL6957)

Sign In for Pricing
View Details
MRX52 AAV siRNA Pooled Vector
30665161 1.0 µg

MRX52 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
PKC theta (PRKCQ) (NM_006257) Human Over-expression Lysate
LS005588-20ug 20 µg

PKC theta (PRKCQ) (NM_006257) Human Over-expression Lysate

Sign In for Pricing
View Details
SPP1 Rabbit pAb
MBS8544373-01 0.1 mL

SPP1 Rabbit pAb

Sign In for Pricing
View Details