Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Hypoxanthine-guanine phosphoribosyltransferase (HPRT1)

Product Specifications

CAS Number

9000-83-3

Gene Name

HPRT1

UniProt

P00492

Expression Region

MHHHHHHHHHHGALFLAFLAAALSLMGLWSQPKKKRKVWEAALAEALAEALAEHLAEALAEALEALAAGGGGSGFLGPAPAPAPAPA+2-218aa

Organism

Homo sapiens

Target Sequence

ATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA

Tag

N-terminal 10xHis-tagged

Source

E.coli

Field of Research

Metabolism

Assay Type

Developed Protein

Relevance

Converts guanine to guanosine monophosphate, and hypoxanthine to inosine monophosphate. Transfers the 5-phosphoribosyl group from 5-phosphoribosylpyrophosphate onto the purine. Plays a central role in the generation of purine nucleotides through the purine salvage pathway.

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Length

Full Length of Mature Protein

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

33.4 kDa

References & Citations

Isolation and characterization of a full-length expressible cDNA for human hypoxanthine phosphoribosyl transferase.Jolly D.J., Okayama H., Berg P., Esty A.C., Filpula D., Bohlen P., Johnson G.G., Shively J.E., Hunkapillar T., Friedmann T.Proc. Natl. Acad. Sci. U.S.A. 80:477-481 (1983)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pcsk2 ORF Vector (Rat) (pORF)
ORF073224 1.0 µg DNA

Pcsk2 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Complexin1, Recombinant, Human, aa1-134, His-Tag
349808-01 100 µg

Complexin1, Recombinant, Human, aa1-134, His-Tag

Sign In for Pricing
View Details
Complexin1, Recombinant, Human, aa1-134, His-Tag
349808-02 500 µg

Complexin1, Recombinant, Human, aa1-134, His-Tag

Sign In for Pricing
View Details
Mouse Monoclonal AlphaB Crystallin/CRYAB Antibody (CRYAB/7918) [Alexa Fluor 405]
NBP3-20796AF405 0.1 mL

Mouse Monoclonal AlphaB Crystallin/CRYAB Antibody (CRYAB/7918) [Alexa Fluor 405]

Sign In for Pricing
View Details
PKD1/PKC mu Antibody
MBS9613888-01 0.1 mL

PKD1/PKC mu Antibody

Sign In for Pricing
View Details
PKD1/PKC mu Antibody
MBS9613888-02 0.2 mL

PKD1/PKC mu Antibody

Sign In for Pricing
View Details