Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1R1, Human (HEK293, His)

IL-1R1 (CD121a) belongs to IL-1 receptor, and binds to IL-1α, IL-1β, IL-1Ra and IL-38 with comparable affinities (Kd: 0.1-1 nM) [1]. IL-1R1 regulates the transcription of multiple proinflammatory cytokines and mediates immune and inflammatory responses, including the activation of NF-κB and MAPK pathway[4]. IL-1R1 Protein, Human (HEK293, His) is a recombinant human extracellular region of IL-1R1 (L18-T332) with a C-Terminal 6*His tag, which is produced in HEK293 cells.

Product Specifications

Product Name Alternative

IL-1R1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1r1-protein-human-315a-a-hek293-his.html

Purity

95.0

Smiles

LEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYPVT

Molecular Formula

3554 (Gene_ID) P14778/NP_000868.1 (L18-T332) (Accession)

Molecular Weight

45-62 kDa

References & Citations

[1]Diana Boraschi, et al. The family of the interleukin-1 receptors. Immunol Rev. 2018 Jan;281 (1) :197-232.|[2]Daniel P Nemeth, et al. Modulation of Neural Networks by Interleukin-1. Brain Plast. 2021 Aug 23;7 (1) :17-32.|[3]Naoe Kaneko, et al. The role of interleukin-1 in general pathology. Inflamm Regen. 2019 Jun 6;39:12.|[4]Yonggang Sha, et al. A role of IL-1R1 signaling in the differentiation of Th17 cells and the development of autoimmune diseases. Self Nonself. 2011 Jan;2 (1) :35-42.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 6 (LRP6)
MBS2070073-01 0.1 mL

FITC-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 6 (LRP6)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 6 (LRP6)
MBS2070073-02 0.2 mL

FITC-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 6 (LRP6)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 6 (LRP6)
MBS2070073-03 0.5 mL

FITC-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 6 (LRP6)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 6 (LRP6)
MBS2070073-04 1 mL

FITC-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 6 (LRP6)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 6 (LRP6)
MBS2070073-05 5 mL

FITC-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 6 (LRP6)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 6 (LRP6)
MBS2070073-06 5x 5 mL

FITC-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 6 (LRP6)

Sign In for Pricing
View Details