Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NOV/CCN3, Mouse (HEK293, His)

The NOV/CCN3 protein is an early player that coordinates diverse cellular processes such as proliferation, adhesion, migration, differentiation, and survival.By interacting with membrane receptors such as integrins or NOTCH1, it regulates hematopoietic stem cells and inhibits myogenic differentiation while affecting the expression of cell cycle regulators.NOV/CCN3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived NOV/CCN3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

NOV/CCN3 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ccn3-protein-mouse-hek-293-his.html

Purity

95.0

Smiles

SLRCPSRCPPKCPSISPTCAPGVRSVLDGCSCCPVCARQRGESCSEMRPCDQSSGLYCDRSADPNNQTGICMVPEGDNCVFDGVIYRNGEKFEPNCQYFCTCRDGQIGCLPRCQLDVLLPGPDCPAPRKVAVPGECCEKWTCGSDEQGTQGTLGGLALPAYRPEATVGVEVSDSSINCIEQTTEWSACSKSCGMGVSTRVTNRNRQCEMVKQTRLCIVRPCEQEPEEVTDKKGKKCLRTKKSLKAIHLQFENCTSLYTYKPRFCGVCSDGRCCTPHNTKTIQVEFQCLPGEIIKKPVMVIGTCTCYSNCPQNNEAFLQDLELKTSRGEI

Molecular Formula

18133 (Gene_ID) Q64299 (S26-I354) (Accession)

Molecular Weight

Approximately 50.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR146, ID (GPR146, PGR8, Probable G-protein coupled receptor 146, G-protein coupled receptor PGR8) (PE) discontinued
036224-PE 200 µL

GPR146, ID (GPR146, PGR8, Probable G-protein coupled receptor 146, G-protein coupled receptor PGR8) (PE) discontinued

Sign In for Pricing
View Details
Abhd13 (NM_026868) Mouse Untagged Clone
MC210815 10 µg

Abhd13 (NM_026868) Mouse Untagged Clone

Sign In for Pricing
View Details
Recombinant Human CD68/SR-D1 His-tag Protein CF
10551-SR-050 50 µg

Recombinant Human CD68/SR-D1 His-tag Protein CF

Sign In for Pricing
View Details
Rtn4r Mouse shRNA Lentiviral Particle (Locus ID 65079)
TL503488V 500 µL Each

Rtn4r Mouse shRNA Lentiviral Particle (Locus ID 65079)

Sign In for Pricing
View Details
FABP3 (Fatty Acid Binding Protein 3, Muscle and Heart (mammary-Derived Growth Inhibitor), FABP11, H-FABP, MDGI, O-FABP) (Biotin)
MBS6172780-01 0.1 mL

FABP3 (Fatty Acid Binding Protein 3, Muscle and Heart (mammary-Derived Growth Inhibitor), FABP11, H-FABP, MDGI, O-FABP) (Biotin)

Sign In for Pricing
View Details
FABP3 (Fatty Acid Binding Protein 3, Muscle and Heart (mammary-Derived Growth Inhibitor), FABP11, H-FABP, MDGI, O-FABP) (Biotin)
MBS6172780-02 5x 0.1 mL

FABP3 (Fatty Acid Binding Protein 3, Muscle and Heart (mammary-Derived Growth Inhibitor), FABP11, H-FABP, MDGI, O-FABP) (Biotin)

Sign In for Pricing
View Details