Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NOV/CCN3, Mouse (HEK293, His)

The NOV/CCN3 protein is an early player that coordinates diverse cellular processes such as proliferation, adhesion, migration, differentiation, and survival.By interacting with membrane receptors such as integrins or NOTCH1, it regulates hematopoietic stem cells and inhibits myogenic differentiation while affecting the expression of cell cycle regulators.NOV/CCN3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived NOV/CCN3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

NOV/CCN3 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ccn3-protein-mouse-hek-293-his.html

Purity

95.0

Smiles

SLRCPSRCPPKCPSISPTCAPGVRSVLDGCSCCPVCARQRGESCSEMRPCDQSSGLYCDRSADPNNQTGICMVPEGDNCVFDGVIYRNGEKFEPNCQYFCTCRDGQIGCLPRCQLDVLLPGPDCPAPRKVAVPGECCEKWTCGSDEQGTQGTLGGLALPAYRPEATVGVEVSDSSINCIEQTTEWSACSKSCGMGVSTRVTNRNRQCEMVKQTRLCIVRPCEQEPEEVTDKKGKKCLRTKKSLKAIHLQFENCTSLYTYKPRFCGVCSDGRCCTPHNTKTIQVEFQCLPGEIIKKPVMVIGTCTCYSNCPQNNEAFLQDLELKTSRGEI

Molecular Formula

18133 (Gene_ID) Q64299 (S26-I354) (Accession)

Molecular Weight

Approximately 50.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bromophenol Blue Sodium Salt, 0.04%
40220103-2 1 L

Bromophenol Blue Sodium Salt, 0.04%

Sign In for Pricing
View Details
ANKS3 Human qPCR Primer Pair (NM_133450)
HP216856 200 Reactions

ANKS3 Human qPCR Primer Pair (NM_133450)

Sign In for Pricing
View Details
SULT2A1 (NM_003167) Human Over-expression Lysate
LH06548V 100 µg

SULT2A1 (NM_003167) Human Over-expression Lysate

Sign In for Pricing
View Details
HACD2 Antibody, FITC conjugated
A59085-50UG 50 µg

HACD2 Antibody, FITC conjugated

Sign In for Pricing
View Details
SKA3 Human shRNA Plasmid Kit (Locus ID 221150)
TL306220 1 Kit

SKA3 Human shRNA Plasmid Kit (Locus ID 221150)

Sign In for Pricing
View Details
MMP7 (9E16) Mouse Monoclonal antibody
E28PE1515 100 µL

MMP7 (9E16) Mouse Monoclonal antibody

Sign In for Pricing
View Details