Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NOV/CCN3, Mouse (HEK293, His)

The NOV/CCN3 protein is an early player that coordinates diverse cellular processes such as proliferation, adhesion, migration, differentiation, and survival.By interacting with membrane receptors such as integrins or NOTCH1, it regulates hematopoietic stem cells and inhibits myogenic differentiation while affecting the expression of cell cycle regulators.NOV/CCN3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived NOV/CCN3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

NOV/CCN3 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ccn3-protein-mouse-hek-293-his.html

Purity

95.0

Smiles

SLRCPSRCPPKCPSISPTCAPGVRSVLDGCSCCPVCARQRGESCSEMRPCDQSSGLYCDRSADPNNQTGICMVPEGDNCVFDGVIYRNGEKFEPNCQYFCTCRDGQIGCLPRCQLDVLLPGPDCPAPRKVAVPGECCEKWTCGSDEQGTQGTLGGLALPAYRPEATVGVEVSDSSINCIEQTTEWSACSKSCGMGVSTRVTNRNRQCEMVKQTRLCIVRPCEQEPEEVTDKKGKKCLRTKKSLKAIHLQFENCTSLYTYKPRFCGVCSDGRCCTPHNTKTIQVEFQCLPGEIIKKPVMVIGTCTCYSNCPQNNEAFLQDLELKTSRGEI

Molecular Formula

18133 (Gene_ID) Q64299 (S26-I354) (Accession)

Molecular Weight

Approximately 50.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLK4 (Serine/threonine-protein Kinase PLK4, Polo-like Kinase 4, PLK-4, Serine/Threonine-protein Kinase 18, Serine/Threonine-protein Kinase Sak, SAK, STK18) (Biotin)
MBS6143616-01 0.1 mL

PLK4 (Serine/threonine-protein Kinase PLK4, Polo-like Kinase 4, PLK-4, Serine/Threonine-protein Kinase 18, Serine/Threonine-protein Kinase Sak, SAK, STK18) (Biotin)

Sign In for Pricing
View Details
PLK4 (Serine/threonine-protein Kinase PLK4, Polo-like Kinase 4, PLK-4, Serine/Threonine-protein Kinase 18, Serine/Threonine-protein Kinase Sak, SAK, STK18) (Biotin)
MBS6143616-02 5x 0.1 mL

PLK4 (Serine/threonine-protein Kinase PLK4, Polo-like Kinase 4, PLK-4, Serine/Threonine-protein Kinase 18, Serine/Threonine-protein Kinase Sak, SAK, STK18) (Biotin)

Sign In for Pricing
View Details
Sequestosome 1 (SQSTM1) Antibody (ATTO594)
abx446559 100 µg

Sequestosome 1 (SQSTM1) Antibody (ATTO594)

Sign In for Pricing
View Details
Rabbit Polyclonal BBS5 Antibody
NBP2-87066 100 µL

Rabbit Polyclonal BBS5 Antibody

Sign In for Pricing
View Details
3-Bromo-5-hydroxypyridine
TRC-B684472-1G 1 g

3-Bromo-5-hydroxypyridine

Sign In for Pricing
View Details
Mouse Monoclonal IL-3R alpha/CD123 Antibody (32703) [Biotin]
FAB301B 0.1 mL

Mouse Monoclonal IL-3R alpha/CD123 Antibody (32703) [Biotin]

Sign In for Pricing
View Details