Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NOV/CCN3, Mouse (HEK293, His)

The NOV/CCN3 protein is an early player that coordinates diverse cellular processes such as proliferation, adhesion, migration, differentiation, and survival.By interacting with membrane receptors such as integrins or NOTCH1, it regulates hematopoietic stem cells and inhibits myogenic differentiation while affecting the expression of cell cycle regulators.NOV/CCN3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived NOV/CCN3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

NOV/CCN3 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ccn3-protein-mouse-hek-293-his.html

Purity

95.0

Smiles

SLRCPSRCPPKCPSISPTCAPGVRSVLDGCSCCPVCARQRGESCSEMRPCDQSSGLYCDRSADPNNQTGICMVPEGDNCVFDGVIYRNGEKFEPNCQYFCTCRDGQIGCLPRCQLDVLLPGPDCPAPRKVAVPGECCEKWTCGSDEQGTQGTLGGLALPAYRPEATVGVEVSDSSINCIEQTTEWSACSKSCGMGVSTRVTNRNRQCEMVKQTRLCIVRPCEQEPEEVTDKKGKKCLRTKKSLKAIHLQFENCTSLYTYKPRFCGVCSDGRCCTPHNTKTIQVEFQCLPGEIIKKPVMVIGTCTCYSNCPQNNEAFLQDLELKTSRGEI

Molecular Formula

18133 (Gene_ID) Q64299 (S26-I354) (Accession)

Molecular Weight

Approximately 50.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LAMP-1 (H4A3) Alexa Fluor® 488
sc-20011 AF488 200 µg/mL

LAMP-1 (H4A3) Alexa Fluor® 488

Sign In for Pricing
View Details
Human WAP four-disulfide core domain protein 12 (WFDC12) ELISA Kit
NSL0173Hu 96 Tests

Human WAP four-disulfide core domain protein 12 (WFDC12) ELISA Kit

Sign In for Pricing
View Details
Recombinant Danio rerio Endoplasmic reticulum-Golgi intermediate compartment protein 2 (ergic2), partial
MBS7090557 Inquire

Recombinant Danio rerio Endoplasmic reticulum-Golgi intermediate compartment protein 2 (ergic2), partial

Sign In for Pricing
View Details
Hao2 (NM_019545) Mouse Tagged Lenti ORF Clone
MR205377L3 10 µg

Hao2 (NM_019545) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Beclin 1 (BECN1, GT197, Beclin-1, Coiled-coil myosin-like BCL2-interacting protein, Protein GT197) (FITC) discontinued
032482-FITC 200 µL

Beclin 1 (BECN1, GT197, Beclin-1, Coiled-coil myosin-like BCL2-interacting protein, Protein GT197) (FITC) discontinued

Sign In for Pricing
View Details
Papillary renal cell carcinoma (PRCC) (NM_005973) Human Recombinant Protein
TP303805L 1 mg

Papillary renal cell carcinoma (PRCC) (NM_005973) Human Recombinant Protein

Sign In for Pricing
View Details