Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NOV/CCN3, Mouse (HEK293, His)

The NOV/CCN3 protein is an early player that coordinates diverse cellular processes such as proliferation, adhesion, migration, differentiation, and survival.By interacting with membrane receptors such as integrins or NOTCH1, it regulates hematopoietic stem cells and inhibits myogenic differentiation while affecting the expression of cell cycle regulators.NOV/CCN3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived NOV/CCN3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

NOV/CCN3 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ccn3-protein-mouse-hek-293-his.html

Purity

95.0

Smiles

SLRCPSRCPPKCPSISPTCAPGVRSVLDGCSCCPVCARQRGESCSEMRPCDQSSGLYCDRSADPNNQTGICMVPEGDNCVFDGVIYRNGEKFEPNCQYFCTCRDGQIGCLPRCQLDVLLPGPDCPAPRKVAVPGECCEKWTCGSDEQGTQGTLGGLALPAYRPEATVGVEVSDSSINCIEQTTEWSACSKSCGMGVSTRVTNRNRQCEMVKQTRLCIVRPCEQEPEEVTDKKGKKCLRTKKSLKAIHLQFENCTSLYTYKPRFCGVCSDGRCCTPHNTKTIQVEFQCLPGEIIKKPVMVIGTCTCYSNCPQNNEAFLQDLELKTSRGEI

Molecular Formula

18133 (Gene_ID) Q64299 (S26-I354) (Accession)

Molecular Weight

Approximately 50.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TARS (Threonyl-tRNA Synthetase, Cytoplasmic, Threonine-tRNA Ligase, ThrRS, MGC9344) (FITC)
134224-FITC 100 µL

TARS (Threonyl-tRNA Synthetase, Cytoplasmic, Threonine-tRNA Ligase, ThrRS, MGC9344) (FITC)

Sign In for Pricing
View Details
Pax5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4383405 3x 1.0 µg

Pax5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Mouse GPR139 shRNA Plasmid
abx980638-01 150 µg

Mouse GPR139 shRNA Plasmid

Sign In for Pricing
View Details
Mouse GPR139 shRNA Plasmid
abx980638-02 300 µg

Mouse GPR139 shRNA Plasmid

Sign In for Pricing
View Details
PCP-2 CRISPR Activation Plasmid (h2)
sc-402817-ACT-2 20 µg

PCP-2 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
HRASLS3 (PLA2G16) Mouse Monoclonal Antibody [Clone ID: OTI1E9]
TA506967 100 µL

HRASLS3 (PLA2G16) Mouse Monoclonal Antibody [Clone ID: OTI1E9]

Sign In for Pricing
View Details