Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NOV/CCN3, Mouse (HEK293, His)

The NOV/CCN3 protein is an early player that coordinates diverse cellular processes such as proliferation, adhesion, migration, differentiation, and survival.By interacting with membrane receptors such as integrins or NOTCH1, it regulates hematopoietic stem cells and inhibits myogenic differentiation while affecting the expression of cell cycle regulators.NOV/CCN3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived NOV/CCN3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

NOV/CCN3 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ccn3-protein-mouse-hek-293-his.html

Purity

95.0

Smiles

SLRCPSRCPPKCPSISPTCAPGVRSVLDGCSCCPVCARQRGESCSEMRPCDQSSGLYCDRSADPNNQTGICMVPEGDNCVFDGVIYRNGEKFEPNCQYFCTCRDGQIGCLPRCQLDVLLPGPDCPAPRKVAVPGECCEKWTCGSDEQGTQGTLGGLALPAYRPEATVGVEVSDSSINCIEQTTEWSACSKSCGMGVSTRVTNRNRQCEMVKQTRLCIVRPCEQEPEEVTDKKGKKCLRTKKSLKAIHLQFENCTSLYTYKPRFCGVCSDGRCCTPHNTKTIQVEFQCLPGEIIKKPVMVIGTCTCYSNCPQNNEAFLQDLELKTSRGEI

Molecular Formula

18133 (Gene_ID) Q64299 (S26-I354) (Accession)

Molecular Weight

Approximately 50.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Donkey Tubulin--Tyrosine Ligase-Like Protein 12 (TTLL12) ELISA Kit
MBS9941420 Inquire

Donkey Tubulin--Tyrosine Ligase-Like Protein 12 (TTLL12) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal FAIM1 Antibody [FITC]
NBP2-97561F 0.1 mL

Rabbit Polyclonal FAIM1 Antibody [FITC]

Sign In for Pricing
View Details
Rabbit Monoclonal PHOX2B Antibody (PHOX2B/7161R) [DyLight 350]
NBP3-20798UV 0.1 mL

Rabbit Monoclonal PHOX2B Antibody (PHOX2B/7161R) [DyLight 350]

Sign In for Pricing
View Details
NR0B1 (Nuclear Receptor Subfamily 0 Group B Member 1, DSS-AHC Critical Region on the X Chromosome Protein 1, Nuclear Receptor DAX-1, AHC, DAX1, HHG) (Biotin)
138190-Biotin 100 µL

NR0B1 (Nuclear Receptor Subfamily 0 Group B Member 1, DSS-AHC Critical Region on the X Chromosome Protein 1, Nuclear Receptor DAX-1, AHC, DAX1, HHG) (Biotin)

Sign In for Pricing
View Details
Recombinant Macrococcus caseolyticus Putative sporulation transcription regulator WhiA (whiA)
MBS1033790-01 0.02 mg (E-Coli)

Recombinant Macrococcus caseolyticus Putative sporulation transcription regulator WhiA (whiA)

Sign In for Pricing
View Details
Recombinant Macrococcus caseolyticus Putative sporulation transcription regulator WhiA (whiA)
MBS1033790-02 0.02 mg (Yeast)

Recombinant Macrococcus caseolyticus Putative sporulation transcription regulator WhiA (whiA)

Sign In for Pricing
View Details