Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NOV/CCN3, Mouse (HEK293, His)

The NOV/CCN3 protein is an early player that coordinates diverse cellular processes such as proliferation, adhesion, migration, differentiation, and survival.By interacting with membrane receptors such as integrins or NOTCH1, it regulates hematopoietic stem cells and inhibits myogenic differentiation while affecting the expression of cell cycle regulators.NOV/CCN3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived NOV/CCN3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

NOV/CCN3 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ccn3-protein-mouse-hek-293-his.html

Purity

95.0

Smiles

SLRCPSRCPPKCPSISPTCAPGVRSVLDGCSCCPVCARQRGESCSEMRPCDQSSGLYCDRSADPNNQTGICMVPEGDNCVFDGVIYRNGEKFEPNCQYFCTCRDGQIGCLPRCQLDVLLPGPDCPAPRKVAVPGECCEKWTCGSDEQGTQGTLGGLALPAYRPEATVGVEVSDSSINCIEQTTEWSACSKSCGMGVSTRVTNRNRQCEMVKQTRLCIVRPCEQEPEEVTDKKGKKCLRTKKSLKAIHLQFENCTSLYTYKPRFCGVCSDGRCCTPHNTKTIQVEFQCLPGEIIKKPVMVIGTCTCYSNCPQNNEAFLQDLELKTSRGEI

Molecular Formula

18133 (Gene_ID) Q64299 (S26-I354) (Accession)

Molecular Weight

Approximately 50.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFITM5 (NM_001025295) Human Tagged Lenti ORF Clone
RC213834L3 10 µg

IFITM5 (NM_001025295) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
SS5R Antibody
ABD2780 100 µg

SS5R Antibody

Sign In for Pricing
View Details
PLRG1 Protein Vector (Human) (pPB-N-His)
PV031778 500 ng

PLRG1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Fbxo7 sgRNA CRISPR Lentivector set (Mouse)
K3533001 3x 1.0 µg

Fbxo7 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Recombinant Shigella Boydii rplE Protein (aa 1-179) (strain Sb227)
VAng-Lsx08801-500gEcoli 500 µg (E. coli)

Recombinant Shigella Boydii rplE Protein (aa 1-179) (strain Sb227)

Sign In for Pricing
View Details
PDHB Human qPCR Template Standard (NM_000925)
HK205491 1 Kit

PDHB Human qPCR Template Standard (NM_000925)

Sign In for Pricing
View Details