Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacteria phage M13 Attachment protein G3P (III)

Product Specifications

Product Name Alternative

Gene 3 protein Short name: G3P Minor coat protein

Abbreviation

Recombinant Enterobacteria phage M13 Attachment protein G3P

Gene Name

III

UniProt

P69168

Expression Region

19-424aa

Organism

Enterobacteria phage M13 (Bacteriophage M13)

Target Sequence

AETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENEGGGSEGGGSEGGGSEGGGTKPPEYGDTPIPGYTYINPLDGTYPPGTEQNPANPNPSLEESQPLNTFMFQNNRFRNRQGALTVYTGTVTQGTDPVKTYYQYTPVSSKAMYDAYWNGKFRDCAFHSGFNEDPFVCEYQGQSSDLPQPPVNAGGGSGGGSGGGSEGGGSEGGGSEGGGSEGGGSGGGSGSGDFDYEKMANANKGAMTENADENALQSDAKGKLDSVATDYGAAIDGFIGDVSGLANGNGATGDFAGSNSQMAQVGDGDNSPLMNNFRQYLPSLPQSVECRPFVFSAGKPYEFSIDCDKINLFRGVFAFLLYVATFMYVFSTFANILRNKES

Tag

N-terminal 10xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Plays essential roles both in the penetration of the viral genome into the bacterial host via pilus retraction and in the extrusion process. During the initial step of infection, G3P mediates adsorption of the phage to its primary receptor, the tip of host F-pilus. Subsequent interaction with the host entry receptor tolA induces penetration of the viral DNA into the host cytoplasm. In the extrusion process, G3P mediates the release of the membrane-anchored virion from the cell via its C-terminal domain.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

48.6 kDa

References & Citations

"Filamentous phage infection: crystal structure of g3p in complex with its coreceptor, the C-terminal domain of TolA."Lubkowski J., Hennecke F., Plueckthun A., Wlodawer A.Structure 7:711-722 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal CD20 Antibody (L26) [DyLight 488]
NBP2-80486G 0.1 mL

Mouse Monoclonal CD20 Antibody (L26) [DyLight 488]

Ask
View Details
Human Potassium channel subfamily K member 9 (KCNK9) ELISA Kit
MBS281492-01 48 Tests

Human Potassium channel subfamily K member 9 (KCNK9) ELISA Kit

Ask
View Details
Human Potassium channel subfamily K member 9 (KCNK9) ELISA Kit
MBS281492-02 96 Tests

Human Potassium channel subfamily K member 9 (KCNK9) ELISA Kit

Ask
View Details
Human Potassium channel subfamily K member 9 (KCNK9) ELISA Kit
MBS281492-03 5x 96 Tests

Human Potassium channel subfamily K member 9 (KCNK9) ELISA Kit

Ask
View Details
Human Potassium channel subfamily K member 9 (KCNK9) ELISA Kit
MBS281492-04 10x 96 Tests

Human Potassium channel subfamily K member 9 (KCNK9) ELISA Kit

Ask
View Details
Recombinant Staphylococcus aureus Enterotoxin type E (entE)
RPC20109-01 20 µg

Recombinant Staphylococcus aureus Enterotoxin type E (entE)

Ask
View Details