LSM4, Human (His)
The LSM4 protein plays a crucial role in pre-mRNA splicing, participating in the U4/U6-U5 tri-snRNP complex during spliceosome assembly, and as a component of the precatalytic spliceosome (spliceosome B complex) .In the heptameric LSM2-8 complex, LSM4 specifically binds to the 3' U region of U6 snRNA.LSM4 Protein, Human (His) is the recombinant human-derived LSM4 protein, expressed by E.coli , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
LSM4 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/lsm4-protein-human-his.html
Smiles
MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVKEEVVAKGRGRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGKQ
Molecular Formula
25804 (Gene_ID) Q9Y4Z0 (M1-Q139) (Accession)
Molecular Weight
Approximately 17 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
![Rabbit Polyclonal DREF Antibody [mFluor Violet 610 SE]](https://cdn.genprice.uk/genprice/uk/genprice4.webp)