Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BRCC36, Human (His-SUMO)

BRCC36 is a metalloprotease that selectively cleaves "Lys-63" linked polyubiquitin chains, especially histones H2A and H2AX in the BRCA1-A complex during the DNA damage response. As the catalytic subunit of the BRISC complex, it also targets “Lys-63”-linked ubiquitin in various substrates, affecting mitotic spindle assembly and interferon signaling. BRCC36 Protein, Human (His-SUMO) is the recombinant human-derived BRCC36 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

BRCC36 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/brcc36-protein-human-his-sumo.html

Purity

90.00

Smiles

AVQVVQAVQAVHLESDAFLVCLNHALSTEKEEVMGLCIGELNDDTRSDSKFAYTGTEMRTVAEKVDAVRIVHIHSVIILRRSDKRKDRVEISPEQLSAASTEAERLAELTGRPMRVVGWYHSHPHITVWPSHVDVRTQAMYQMMDQGFVGLIFSCFIEDKNTKTGRVLYTCFQSIQAQKSSESLHGPRDFWSSSQHISIEGQKEEERYERIEIPIHIVPHVTIGKVCLESAVELPKILCQEEQDAYRRIHSLTHLDSVTKIHNGSVFTKNLCSQMSAVSGPLLQWLEDRLEQNQQHLQELQQEKEELMQELSSLE

Molecular Formula

79184 (Gene_ID) P46736 (A2-E316) (Accession)

Molecular Weight

Approximately 51.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIR1244-2 Human qPCR Primer Pair (MI0015974)
HP300687 200 Reactions

MIR1244-2 Human qPCR Primer Pair (MI0015974)

Sign In for Pricing
View Details
SIGLEC9 (NM_014441) Human Recombinant Protein
TP306674 20 µg

SIGLEC9 (NM_014441) Human Recombinant Protein

Sign In for Pricing
View Details
CD34 Mouse Monoclonal Antibody [Clone ID: OTI10C8]
CF809229 100 µg

CD34 Mouse Monoclonal Antibody [Clone ID: OTI10C8]

Sign In for Pricing
View Details
Arhgdib (NM_007486) Mouse Tagged ORF Clone
MG202044 10 µg

Arhgdib (NM_007486) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Tissue Total RNA, Ovary: right
CR562148 5 µg

Tissue Total RNA, Ovary: right

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS800328 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details