Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BRCC36, Human (His-SUMO)

BRCC36 is a metalloprotease that selectively cleaves "Lys-63" linked polyubiquitin chains, especially histones H2A and H2AX in the BRCA1-A complex during the DNA damage response. As the catalytic subunit of the BRISC complex, it also targets “Lys-63”-linked ubiquitin in various substrates, affecting mitotic spindle assembly and interferon signaling. BRCC36 Protein, Human (His-SUMO) is the recombinant human-derived BRCC36 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

BRCC36 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/brcc36-protein-human-his-sumo.html

Purity

90.00

Smiles

AVQVVQAVQAVHLESDAFLVCLNHALSTEKEEVMGLCIGELNDDTRSDSKFAYTGTEMRTVAEKVDAVRIVHIHSVIILRRSDKRKDRVEISPEQLSAASTEAERLAELTGRPMRVVGWYHSHPHITVWPSHVDVRTQAMYQMMDQGFVGLIFSCFIEDKNTKTGRVLYTCFQSIQAQKSSESLHGPRDFWSSSQHISIEGQKEEERYERIEIPIHIVPHVTIGKVCLESAVELPKILCQEEQDAYRRIHSLTHLDSVTKIHNGSVFTKNLCSQMSAVSGPLLQWLEDRLEQNQQHLQELQQEKEELMQELSSLE

Molecular Formula

79184 (Gene_ID) P46736 (A2-E316) (Accession)

Molecular Weight

Approximately 51.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Protein G Colloidal Gold, 1mL 5nm
GP-02-5 1 mL

Protein G Colloidal Gold, 1mL 5nm

Sign In for Pricing
View Details
CD38 Antibody (Biotin)
KB-3564-01 50 μL

CD38 Antibody (Biotin)

Sign In for Pricing
View Details
CD38 Antibody (Biotin)
KB-3564-02 100 µL

CD38 Antibody (Biotin)

Sign In for Pricing
View Details
CD38 Antibody (Biotin)
KB-3564-03 1 mL

CD38 Antibody (Biotin)

Sign In for Pricing
View Details
CLEC9A / DNGR1 (Dendritic Cell Marker) (8F9), CF740 conjugate, 0.1mg/mL
BNC743063-100 1x 100 µL

CLEC9A / DNGR1 (Dendritic Cell Marker) (8F9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
o-Nitrophenyl 2-Acetamido-2-deoxy-Alpha-D-galactopyranoside
TRC-N499250-50MG 50 mg

o-Nitrophenyl 2-Acetamido-2-deoxy-Alpha-D-galactopyranoside

Sign In for Pricing
View Details