Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Thy1/CD90, Human (HEK293)

Thy-1 membrane glycoprotein (THY1, CD90) is a cell surface glycoprotein and member of the immunoglobulin superfamily of proteins. THY1 is involved in cell adhesion and cell communication particularly in cells of the immune and nervous systems. THY1 may function as a tumor suppressor in nasopharyngeal carcinoma and may play a role in cell-cell or cell-ligand interactions during synaptogenesis and other events in the brain. Thy1/CD90 Protein, Human (HEK293) is the recombinant human-derived Thy1/CD90 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

Thy1/CD90 Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/thy1-cd90-protein-human-hek293.html

Purity

95.0

Smiles

QKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKC

Molecular Formula

7070 (Gene_ID) P04216/NP_006279.2 (Q20-C130) (Accession)

Molecular Weight

Approximately 23-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Kidney
CS504065 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Calponin (CNN1) (NM_001299) Human Over-expression Lysate
LY400519 100 µg

Calponin (CNN1) (NM_001299) Human Over-expression Lysate

Sign In for Pricing
View Details
ICA1 Antibody
OC-047-01 50 μL

ICA1 Antibody

Sign In for Pricing
View Details
ICA1 Antibody
OC-047-02 100 µL

ICA1 Antibody

Sign In for Pricing
View Details
ICA1 Antibody
OC-047-03 1 mL

ICA1 Antibody

Sign In for Pricing
View Details
4-[(Phenyl-13C6)-amino]-1-benzyl-4-piperidinecarboxamide
TRC-P307487-5MG 5 mg

4-[(Phenyl-13C6)-amino]-1-benzyl-4-piperidinecarboxamide

Sign In for Pricing
View Details