OSM, Mouse
OSM Protein, Mouse is a gp130 cytokine family member, shows homeostatic and proinflammatory activities and can modify extracellular matrix.
Product Specifications
Product Name Alternative
OSM Protein, Mouse, Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/osm-protein-mouse.html
Purity
95.00
Smiles
MNRGCSNSSSQLLSQLQNQANLTGNTESLLEPYIRLQNLNTPDLRAACTQHSVAFPSEDTLRQLSKPHFLSTVYTTLDRVLYQLDALRQKFLKTPAFPKLDSARHNILGIRNNVFCMARLLNHSLEIPEPTQTDSGASRSTTTPDVFNTKIGSCGFLWGYHRFMGSVGRVFREWDDGSTRSR
Molecular Formula
18413 (Gene_ID) P53347 (N25-R205) (Accession)
Molecular Weight
Approximately 20.5 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Richards CD, et al. Regulation of IL-33 by Oncostatin M in Mouse Lung Epithelial Cells. Mediators Inflamm. 2016;2016:9858374.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
C7850-19D1-ML490 100 µL
Complement Component 4 Binding Protein (C4 Binding Protein, C4BP, Complement Component 4 Binding Protein alpha Chain, C4b Binding Protein alpha Chain, C4BPA, Complement Component 4 Binding Protein beta Chain, C4b Binding Protein beta Chain, C4BPB, Proline-rich Protein, PRP) (MaxLight 490)
Sign In for Pricing
View Details F4149-02A 50 µL
FGR (Tyrosine-protein Kinase Fgr, Proto-oncogene c-Fgr, p55-Fgr, SRC2) discontinued
Sign In for Pricing
View Details AE33751BO-01 48 Tests
Bovine LDLR chaperone MESD (MESDC2) ELISA Kit
Sign In for Pricing
View Details