Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OSM, Mouse

OSM Protein, Mouse is a gp130 cytokine family member, shows homeostatic and proinflammatory activities and can modify extracellular matrix.

Product Specifications

Product Name Alternative

OSM Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/osm-protein-mouse.html

Purity

95.00

Smiles

MNRGCSNSSSQLLSQLQNQANLTGNTESLLEPYIRLQNLNTPDLRAACTQHSVAFPSEDTLRQLSKPHFLSTVYTTLDRVLYQLDALRQKFLKTPAFPKLDSARHNILGIRNNVFCMARLLNHSLEIPEPTQTDSGASRSTTTPDVFNTKIGSCGFLWGYHRFMGSVGRVFREWDDGSTRSR

Molecular Formula

18413 (Gene_ID) P53347 (N25-R205) (Accession)

Molecular Weight

Approximately 20.5 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Richards CD, et al. Regulation of IL-33 by Oncostatin M in Mouse Lung Epithelial Cells. Mediators Inflamm. 2016;2016:9858374.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR17 mouse monoclonal antibody,clone OTI17C1
TA811615S 30 µL

GPR17 mouse monoclonal antibody,clone OTI17C1

Sign In for Pricing
View Details
DDEF1 Lentiviral Activation Particles (h2)
sc-406473-LAC-2 200 µL

DDEF1 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
CD68 Mouse mAb Antibody
orb763415 100 µL

CD68 Mouse mAb Antibody

Sign In for Pricing
View Details
Human Procollagen Lysine-2-Oxoglutarate-5-Dioxygenase 3 (PLOD3) ELISA Kit
DLR-PLOD3-Hu-96T 96 Tests

Human Procollagen Lysine-2-Oxoglutarate-5-Dioxygenase 3 (PLOD3) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human ADCY1 Protein, N-His
bs-101853P-01 20 µg

Recombinant Human ADCY1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human ADCY1 Protein, N-His
bs-101853P-02 50 µg

Recombinant Human ADCY1 Protein, N-His

Sign In for Pricing
View Details