Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HLA-DMA, Human (His)

HLA-DMA proteins are key members of the MHC class II family and are essential for antigen presentation and immune response regulation. In this family, HLA-DMA is actively involved in the loading and exchange of peptides within the MHC class II antigen-binding groove. HLA-DMA Protein, Human (His) is the recombinant human-derived HLA-DMA protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

HLA-DMA Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hla-dma-protein-human-his.html

Purity

90

Smiles

VPEAPTPMWPDDLQNHTFLHTVYCQDGSPSVGLSEAYDEDQLFFFDFSQNTRVPRLPEFADWAQEQGDAPAILFDKEFCEWMIQQIGPKLDGKIPVSRGFPIAEVFTLKPLEFGKPNTLVCFVSNLFPPMLTVNWQHHSVPVEGFGPTFVSAVDGLSFQAFSYLNFTPEPSDIFSCIVTHEIDRYTAIAYWVPRNALPSDLLENVLC

Molecular Formula

3108 (Gene_ID) Q6ICR9 (V27-C233) (Accession)

Molecular Weight

Approximately 27 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Droxidopa Benzoate
TRC-D689970-50MG 50 mg

Droxidopa Benzoate

Sign In for Pricing
View Details
Nimetazepam-d3
TRC-N477802-1MG 1 mg

Nimetazepam-d3

Sign In for Pricing
View Details
Recombinant LYN (phospho Y397) Antibody
RC-15237-01 50 μL

Recombinant LYN (phospho Y397) Antibody

Sign In for Pricing
View Details
Recombinant LYN (phospho Y397) Antibody
RC-15237-02 100 µL

Recombinant LYN (phospho Y397) Antibody

Sign In for Pricing
View Details
Recombinant LYN (phospho Y397) Antibody
RC-15237-03 1 mL

Recombinant LYN (phospho Y397) Antibody

Sign In for Pricing
View Details
CDCA4 Rabbit Polyclonal Antibody
TA365614 100 µL

CDCA4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details