Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HLA-DMA, Human (His)

HLA-DMA proteins are key members of the MHC class II family and are essential for antigen presentation and immune response regulation. In this family, HLA-DMA is actively involved in the loading and exchange of peptides within the MHC class II antigen-binding groove. HLA-DMA Protein, Human (His) is the recombinant human-derived HLA-DMA protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

HLA-DMA Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hla-dma-protein-human-his.html

Purity

90

Smiles

VPEAPTPMWPDDLQNHTFLHTVYCQDGSPSVGLSEAYDEDQLFFFDFSQNTRVPRLPEFADWAQEQGDAPAILFDKEFCEWMIQQIGPKLDGKIPVSRGFPIAEVFTLKPLEFGKPNTLVCFVSNLFPPMLTVNWQHHSVPVEGFGPTFVSAVDGLSFQAFSYLNFTPEPSDIFSCIVTHEIDRYTAIAYWVPRNALPSDLLENVLC

Molecular Formula

3108 (Gene_ID) Q6ICR9 (V27-C233) (Accession)

Molecular Weight

Approximately 27 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Polyclonal Antibody
TA396629 100 µg

Goat Polyclonal Antibody

Sign In for Pricing
View Details
RBM28 (NM_018077) Human Over-expression Lysate
LC402646 20 µg

RBM28 (NM_018077) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Pancreas
CS805147 5x 5 µm

Tissue FFPE Sections, Pancreas

Sign In for Pricing
View Details
CEP55 Human Gene Knockout Kit (CRISPR)
KN201052RB 1 Kit

CEP55 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Anti-IRF9
Y058880 100 µg

Anti-IRF9

Sign In for Pricing
View Details
LPHN1 (ADGRL1) Human Gene Knockout Kit (CRISPR)
KN217296RB 1 Kit

LPHN1 (ADGRL1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details