Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HLA-DMA, Human (His)

HLA-DMA proteins are key members of the MHC class II family and are essential for antigen presentation and immune response regulation. In this family, HLA-DMA is actively involved in the loading and exchange of peptides within the MHC class II antigen-binding groove. HLA-DMA Protein, Human (His) is the recombinant human-derived HLA-DMA protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

HLA-DMA Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hla-dma-protein-human-his.html

Purity

90

Smiles

VPEAPTPMWPDDLQNHTFLHTVYCQDGSPSVGLSEAYDEDQLFFFDFSQNTRVPRLPEFADWAQEQGDAPAILFDKEFCEWMIQQIGPKLDGKIPVSRGFPIAEVFTLKPLEFGKPNTLVCFVSNLFPPMLTVNWQHHSVPVEGFGPTFVSAVDGLSFQAFSYLNFTPEPSDIFSCIVTHEIDRYTAIAYWVPRNALPSDLLENVLC

Molecular Formula

3108 (Gene_ID) Q6ICR9 (V27-C233) (Accession)

Molecular Weight

Approximately 27 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

HRP-Linked Polyclonal Antibody to Osteopetrosis Associated Transmembrane Protein 1 (OSTM1)
MBS2067632-01 0.1 mL

HRP-Linked Polyclonal Antibody to Osteopetrosis Associated Transmembrane Protein 1 (OSTM1)

Ask
View Details
HRP-Linked Polyclonal Antibody to Osteopetrosis Associated Transmembrane Protein 1 (OSTM1)
MBS2067632-02 0.2 mL

HRP-Linked Polyclonal Antibody to Osteopetrosis Associated Transmembrane Protein 1 (OSTM1)

Ask
View Details
HRP-Linked Polyclonal Antibody to Osteopetrosis Associated Transmembrane Protein 1 (OSTM1)
MBS2067632-03 0.5 mL

HRP-Linked Polyclonal Antibody to Osteopetrosis Associated Transmembrane Protein 1 (OSTM1)

Ask
View Details
HRP-Linked Polyclonal Antibody to Osteopetrosis Associated Transmembrane Protein 1 (OSTM1)
MBS2067632-04 1 mL

HRP-Linked Polyclonal Antibody to Osteopetrosis Associated Transmembrane Protein 1 (OSTM1)

Ask
View Details
HRP-Linked Polyclonal Antibody to Osteopetrosis Associated Transmembrane Protein 1 (OSTM1)
MBS2067632-05 5 mL

HRP-Linked Polyclonal Antibody to Osteopetrosis Associated Transmembrane Protein 1 (OSTM1)

Ask
View Details
HRP-Linked Polyclonal Antibody to Osteopetrosis Associated Transmembrane Protein 1 (OSTM1)
MBS2067632-06 5x 5 mL

HRP-Linked Polyclonal Antibody to Osteopetrosis Associated Transmembrane Protein 1 (OSTM1)

Ask
View Details