Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HLA-DMA, Human (His)

HLA-DMA proteins are key members of the MHC class II family and are essential for antigen presentation and immune response regulation. In this family, HLA-DMA is actively involved in the loading and exchange of peptides within the MHC class II antigen-binding groove. HLA-DMA Protein, Human (His) is the recombinant human-derived HLA-DMA protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

HLA-DMA Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hla-dma-protein-human-his.html

Purity

90

Smiles

VPEAPTPMWPDDLQNHTFLHTVYCQDGSPSVGLSEAYDEDQLFFFDFSQNTRVPRLPEFADWAQEQGDAPAILFDKEFCEWMIQQIGPKLDGKIPVSRGFPIAEVFTLKPLEFGKPNTLVCFVSNLFPPMLTVNWQHHSVPVEGFGPTFVSAVDGLSFQAFSYLNFTPEPSDIFSCIVTHEIDRYTAIAYWVPRNALPSDLLENVLC

Molecular Formula

3108 (Gene_ID) Q6ICR9 (V27-C233) (Accession)

Molecular Weight

Approximately 27 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse B7-H4/VTCN1 Protein (Fc Tag)
PKSM040966-01 10 µg

Recombinant Mouse B7-H4/VTCN1 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse B7-H4/VTCN1 Protein (Fc Tag)
PKSM040966-02 50 µg

Recombinant Mouse B7-H4/VTCN1 Protein (Fc Tag)

Sign In for Pricing
View Details
1-(4-Chlorophenyl)-1,2-dihydro-3H-pyrazol-3-one
TRC-C377875-5G 5 g

1-(4-Chlorophenyl)-1,2-dihydro-3H-pyrazol-3-one

Sign In for Pricing
View Details
7-Bromo-5-(2-chlorophenyl)-1,3-dihydro-2H-thieno[2,3-e]-1,4-diazepin-2-one
TRC-B682520-5MG 5 mg

7-Bromo-5-(2-chlorophenyl)-1,3-dihydro-2H-thieno[2,3-e]-1,4-diazepin-2-one

Sign In for Pricing
View Details
HPV16 E2 (Human Papilloma Virus 16) (TVG 261), CF405S conjugate, 0.1mg/mL
BNC043073-500 1x 500 µL

HPV16 E2 (Human Papilloma Virus 16) (TVG 261), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
21-Dehydro Cloprednol
TRC-D229175-25MG 25 mg

21-Dehydro Cloprednol

Sign In for Pricing
View Details