Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13R alpha 2, Mouse (HEK293, Fc)

IL-13R alpha 2 Protein, acting as a monomer, displays a strong binding affinity for interleukin-13 (IL-13) . IL-13R alpha 2 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived IL-13R alpha 2 protein, expressed by HEK293 , with C-mFc labeled tag.

Product Specifications

Product Name Alternative

IL-13R alpha 2 Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13r-alpha-2-protein-mouse-hek293-fc.html

Purity

96.30

Smiles

LEIKVNPPQDFEILDPGLLGYLYLQWKPPVVIEKFKGCTLEYELKYRNVDSDSWKTIITRNLIYKDGFDLNKGIEGKIRTHLSEHCTNGSEVQSPWIEASYGISDEGSLETKIQDMKCIYYNWQYLVCSWKPGKTVYSDTNYTMFFWYEGLDHALQCADYLQHDEKNVGCKLSNLDSSDYKDFFICVNGSSKLEPIRSSYTVFQLQNIVKPLPPEFLHISVENSIDIRMKWSTPGGPIPPRCYTYEIVIREDDISWESATDKNDMKLKRRANESEDLCFFVRCKVNIYCADDGIWSEWSEEECWEGYTGPDSK

Molecular Formula

16165 (Gene_ID) O88786-1 (L22-K334) (Accession)

Molecular Weight

Approximately 62.84 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit F box/WD repeat containing protein 12 (FBXW12) ELISA Kit
GTR10358303 96 Well

Rabbit F box/WD repeat containing protein 12 (FBXW12) ELISA Kit

Sign In for Pricing
View Details
Mouse Enoyl-CoA hydratase, mitochondrial ELISA Kit
MBS2886330-01 48 Well

Mouse Enoyl-CoA hydratase, mitochondrial ELISA Kit

Sign In for Pricing
View Details
Mouse Enoyl-CoA hydratase, mitochondrial ELISA Kit
MBS2886330-02 96 Well

Mouse Enoyl-CoA hydratase, mitochondrial ELISA Kit

Sign In for Pricing
View Details
Mouse Enoyl-CoA hydratase, mitochondrial ELISA Kit
MBS2886330-03 5x 96 Well

Mouse Enoyl-CoA hydratase, mitochondrial ELISA Kit

Sign In for Pricing
View Details
Mouse Enoyl-CoA hydratase, mitochondrial ELISA Kit
MBS2886330-04 10x 96 Well

Mouse Enoyl-CoA hydratase, mitochondrial ELISA Kit

Sign In for Pricing
View Details
NPAS2 Protein Lysate (Rat) with C-HA Tag
32037036 100 µg

NPAS2 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details