Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDGF-DD, Human (CHO)

PDGF-DD Protein, Human (CHO) is a member of the PDGF family, specifically binds to and activates its cognate receptor PDGFR-β, and participates in regulating cancer proliferation, transformation, and invasion through activating multiple downstream oncogenic pathways, resulting in tumor development and progression.

Product Specifications

Product Name Alternative

PDGF-DD Protein, Human (CHO), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pdgf-dd-protein-human-cho.html

Purity

95.00

Smiles

SYHDRKSKVDLDRLNDDAKRYSCTPRNYSVNIREELKLANVVFFPRCLLVQRCGGNCGCGTVNWRSCTCNSGKTVKKYHEVLQFEPGHIKRRGRAKTMALVDIQLDHHERCDCICSSRPPR

Molecular Formula

80310 (Gene_ID) Q9GZP0-1 (S250-R370) (Accession)

Molecular Weight

Approximately 19-21 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Huang F, et al. Gastric cancer-derived MSC-secreted PDGF-DD promotes gastric cancer progression. J Cancer Res Clin Oncol. 2014 Nov;140 (11) :1835-48.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GM2 Ganglioside Activator (GM2A) Human ELISA Kit
D7890 96 Tests

GM2 Ganglioside Activator (GM2A) Human ELISA Kit

Sign In for Pricing
View Details
Human pNO40 protein
orb756119-01 50 µg

Human pNO40 protein

Sign In for Pricing
View Details
Human pNO40 protein
orb756119-02 100 µg

Human pNO40 protein

Sign In for Pricing
View Details
Human pNO40 protein
orb756119-03 200 µg

Human pNO40 protein

Sign In for Pricing
View Details
Human pNO40 protein
orb756119-04 1 mg

Human pNO40 protein

Sign In for Pricing
View Details
ZNF259 ORF Vector (Human) (pORF)
51389011 1.0 µg DNA

ZNF259 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details