Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Deleted in azoospermia-like (DAZL), partial

Product Specifications

Product Name Alternative

DAZ homolog; DAZ-like autosomal; Deleted in azoospermia-like 1; SPGY-like-autosomal

Abbreviation

Recombinant Human DAZL protein, partial

Gene Name

DAZL

UniProt

Q92904

Expression Region

130-250aa

Organism

Homo sapiens (Human)

Target Sequence

VFNHPPPPQFQNVWTNPNTETYMQPTTTMNPITQYVQAYPTYPNSPVQVITGYQLPVYNYQMPPQWPVGEQRSYVVPPAYSAVNYHCNEVDPGAEVVPNECSVHEATPPSGNGPQKKSVDR

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Developmental Biology

Relevance

RNA-binding protein, which is essential for gametogenesis in both males and females. Plays a central role during spermatogenesis. Acts by binding to the 3'-UTR of mRNA, specifically recognizing GUU triplets, and thereby regulating the translation of key transcripts.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

31.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD28 (204.12), CF405S conjugate, 0.1mg/mL
BNC040164-500 1x 500 µL

CD28 (204.12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF405S conjugate, 0.1mg/mL
BNC040029-500 1x 500 µL

Fibronectin (TV-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF568 conjugate, 0.1mg/mL
BNC680324-500 1x 500 µL

CD53 (161-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF568 conjugate, 0.1mg/mL
BNC680029-500 1x 500 µL

Fibronectin (TV-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Emerin (Papillary Thyroid Carcinoma and EDMD Marker) (EMD/2167), CF568 conjugate, 0.1mg/mL
BNC682167-100 1x 100 µL

Emerin (Papillary Thyroid Carcinoma and EDMD Marker) (EMD/2167), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (323/A3), CF640R conjugate, 0.1mg/mL
BNC400396-500 1x 500 µL

Ep-CAM / CD326 (323/A3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details