Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella baltica Deoxyuridine 5'-triphosphate nucleotidohydrolase (dut)

Product Specifications

CAS Number

9000-83-3

Gene Name

[dut]

Storage Conditions

Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Other Gene Names

[dut; dUTPase]

Short Name

[Deoxyuridine 5'-triphosphate nucleotidohydrolase (dut)]

Other Product Names

[deoxyuridine 5'-triphosphate nucleotidohydrolase; Deoxyuridine 5'-triphosphate nucleotidohydrolase; dUTP pyrophosphatase]

NCBI GI Number

493005585

NCBI Accession Number

WP_006086674.1

NCBI GB Accession Number

WP_006086674.1

Uniprot Accession Number

A6WIA4

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal protocadherin beta 4 Antibody
NBP2-94386-0.02mL 0.02 mL

Rabbit Polyclonal protocadherin beta 4 Antibody

Sign In for Pricing
View Details
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
HY-P3431 1 Each

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Sign In for Pricing
View Details
Lentiviral human MAPK8IP2 shRNA (UAS) - Lentiviral human MAPK8IP2 shRNA (UAS, iRFP) (100)
GTR15155415 1 Vial

Lentiviral human MAPK8IP2 shRNA (UAS) - Lentiviral human MAPK8IP2 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Droxidopa (hydrochloride)
HY-13458A 1 Each

Droxidopa (hydrochloride)

Sign In for Pricing
View Details
Phalloidin Conjugated Dye 680
S01YF-0223-KX367 1 Vial

Phalloidin Conjugated Dye 680

Sign In for Pricing
View Details
P-Selectin (SELP) Antibody (Biotin)
abx273186-01 200 µL

P-Selectin (SELP) Antibody (Biotin)

Sign In for Pricing
View Details