Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Versican Isoform V0, Human (His, B2M, Myc)

Versican Isoform V3 Protein, involved in intercellular signaling, connects cells to the extracellular matrix, regulating cell motility, growth, and differentiation. It binds hyaluronic acid and interacts with FBLN1. Versican Isoform V0 Protein, Human (His, B2M, Myc) is the recombinant human-derived Versican Isoform V0, expressed by E. coli, with N-B2M, C-Myc, N-10*His labeled tag.

Product Specifications

Product Name Alternative

Versican Isoform V0 Protein, Human (His, B2M, Myc), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/versican-isoform-v0-protein-human-sf9-his-myc.html

Purity

98.00

Smiles

GPDRCKMNPCLNGGTCYPTETSYVCTCVPGYSGDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMN

Molecular Formula

1462 (Gene_ID) P13611-1 (G3089-N3354) (Accession)

Molecular Weight

Approximately 50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal NOX1 Antibody
NBP1-31546 100 µL

Rabbit Polyclonal NOX1 Antibody

Sign In for Pricing
View Details
0610009B22Rik sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4703803 1.0 µg DNA

0610009B22Rik sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Il4 rabbit polyclonal antibody, Biotin
PP011B1 25 µg

Il4 rabbit polyclonal antibody, Biotin

Sign In for Pricing
View Details
TtT/GF Cell Complete Medium
CM-0561 4x 125 mL

TtT/GF Cell Complete Medium

Sign In for Pricing
View Details
Anti-CRIPT antibody
STJ116548 100 µl

Anti-CRIPT antibody

Sign In for Pricing
View Details
Ubl5 ORF Vector (Mouse) (pORF)
ORF060929 1.0 µg DNA

Ubl5 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details