Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Versican Isoform V0, Human (His, B2M, Myc)

Versican Isoform V3 Protein, involved in intercellular signaling, connects cells to the extracellular matrix, regulating cell motility, growth, and differentiation. It binds hyaluronic acid and interacts with FBLN1. Versican Isoform V0 Protein, Human (His, B2M, Myc) is the recombinant human-derived Versican Isoform V0, expressed by E. coli, with N-B2M, C-Myc, N-10*His labeled tag.

Product Specifications

Product Name Alternative

Versican Isoform V0 Protein, Human (His, B2M, Myc), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/versican-isoform-v0-protein-human-sf9-his-myc.html

Purity

98.00

Smiles

GPDRCKMNPCLNGGTCYPTETSYVCTCVPGYSGDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMN

Molecular Formula

1462 (Gene_ID) P13611-1 (G3089-N3354) (Accession)

Molecular Weight

Approximately 50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Interleukin 32, CT (IL-32, Natural Killer Cells Protein 4, NK4, TAIF) (MaxLight 750) discontinued
I8442-42N-ML750 100 µL

Interleukin 32, CT (IL-32, Natural Killer Cells Protein 4, NK4, TAIF) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Lentiviral human C6orf163 shRNA (UAS) - Lentiviral human C6orf163 shRNA (UAS, GFP) plasmid
GTR15135754 1 Vial

Lentiviral human C6orf163 shRNA (UAS) - Lentiviral human C6orf163 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Recombinant Mouse Angpt4 Protein, His (Fc)-Avi-tagged
Angpt4-10520M 50 µg

Recombinant Mouse Angpt4 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
m-Anisidine
MBS6087513-01 25 g

m-Anisidine

Sign In for Pricing
View Details
m-Anisidine
MBS6087513-02 5x 25 g

m-Anisidine

Sign In for Pricing
View Details
Recombinant Human DGKH, N-His
MBS1574955-01 0.1 mg

Recombinant Human DGKH, N-His

Sign In for Pricing
View Details