Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Versican Isoform V0, Human (His, B2M, Myc)

Versican Isoform V3 Protein, involved in intercellular signaling, connects cells to the extracellular matrix, regulating cell motility, growth, and differentiation. It binds hyaluronic acid and interacts with FBLN1. Versican Isoform V0 Protein, Human (His, B2M, Myc) is the recombinant human-derived Versican Isoform V0, expressed by E. coli, with N-B2M, C-Myc, N-10*His labeled tag.

Product Specifications

Product Name Alternative

Versican Isoform V0 Protein, Human (His, B2M, Myc), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/versican-isoform-v0-protein-human-sf9-his-myc.html

Purity

98.00

Smiles

GPDRCKMNPCLNGGTCYPTETSYVCTCVPGYSGDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMN

Molecular Formula

1462 (Gene_ID) P13611-1 (G3089-N3354) (Accession)

Molecular Weight

Approximately 50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ptgir ORF Vector (Rat) (pORF)
ORF074278 1.0 µg DNA

Ptgir ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Xab2 (NM_026156) Mouse Tagged ORF Clone Lentiviral Particle
MR210960L3V 200 µL

Xab2 (NM_026156) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
PALMD (NM_017734) Human Tagged ORF Clone
RG203079 10 µg

PALMD (NM_017734) Human Tagged ORF Clone

Sign In for Pricing
View Details
AKAP7 (NM_016377) Human Tagged ORF Clone
RG219968 10 µg

AKAP7 (NM_016377) Human Tagged ORF Clone

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) At2g21290 Polyclonal Antibody
MBS9010594 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) At2g21290 Polyclonal Antibody

Sign In for Pricing
View Details
Human Coenzyme Q10 Homolog B (COQ10B) ELISA Kit
RD-COQ10B-Hu-48Tests 48 Tests

Human Coenzyme Q10 Homolog B (COQ10B) ELISA Kit

Sign In for Pricing
View Details