Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Versican Isoform V0, Human (His, B2M, Myc)

Versican Isoform V3 Protein, involved in intercellular signaling, connects cells to the extracellular matrix, regulating cell motility, growth, and differentiation. It binds hyaluronic acid and interacts with FBLN1. Versican Isoform V0 Protein, Human (His, B2M, Myc) is the recombinant human-derived Versican Isoform V0, expressed by E. coli, with N-B2M, C-Myc, N-10*His labeled tag.

Product Specifications

Product Name Alternative

Versican Isoform V0 Protein, Human (His, B2M, Myc), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/versican-isoform-v0-protein-human-sf9-his-myc.html

Purity

98.00

Smiles

GPDRCKMNPCLNGGTCYPTETSYVCTCVPGYSGDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMN

Molecular Formula

1462 (Gene_ID) P13611-1 (G3089-N3354) (Accession)

Molecular Weight

Approximately 50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP90AB4P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0996907 1.0 µg DNA

HSP90AB4P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Menin (MEN1) (NM_130799) Human Mutant ORF Clone
RC403701 10 µg

Menin (MEN1) (NM_130799) Human Mutant ORF Clone

Sign In for Pricing
View Details
Mouse Monoclonal NT-proBNP Antibody (5B6cc) [DyLight 594]
NB120-13111DL594 0.2 mL

Mouse Monoclonal NT-proBNP Antibody (5B6cc) [DyLight 594]

Sign In for Pricing
View Details
BSG antibody
10R-3476 100 ul

BSG antibody

Sign In for Pricing
View Details
FAM22B Protein Vector (Human) (pPM-C-HA)
PV077243 500 ng

FAM22B Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
CMD1H Protein Vector (Human) (pPM-C-His)
PV070004 500 ng

CMD1H Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details