Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Versican Isoform V0, Human (His, B2M, Myc)

Versican Isoform V3 Protein, involved in intercellular signaling, connects cells to the extracellular matrix, regulating cell motility, growth, and differentiation. It binds hyaluronic acid and interacts with FBLN1. Versican Isoform V0 Protein, Human (His, B2M, Myc) is the recombinant human-derived Versican Isoform V0, expressed by E. coli, with N-B2M, C-Myc, N-10*His labeled tag.

Product Specifications

Product Name Alternative

Versican Isoform V0 Protein, Human (His, B2M, Myc), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/versican-isoform-v0-protein-human-sf9-his-myc.html

Purity

98.00

Smiles

GPDRCKMNPCLNGGTCYPTETSYVCTCVPGYSGDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMN

Molecular Formula

1462 (Gene_ID) P13611-1 (G3089-N3354) (Accession)

Molecular Weight

Approximately 50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ddx27 ORF Vector (Mouse) (pORF)
ORF042798 1.0 µg DNA

Ddx27 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Magic™ Membrane Protein Human GRAMD1C (GRAM domain containing 1C) Expressed in vitro E.coli expression system, Full Length
MPX1979K Each

Magic™ Membrane Protein Human GRAMD1C (GRAM domain containing 1C) Expressed in vitro E.coli expression system, Full Length

Sign In for Pricing
View Details
TCR beta Blocking Peptide
33R-10581 50 ug

TCR beta Blocking Peptide

Sign In for Pricing
View Details
HLAG (HLA-G) Mouse Monoclonal Antibody [Clone ID: MEM-G/1]
SM1591 200 µg

HLAG (HLA-G) Mouse Monoclonal Antibody [Clone ID: MEM-G/1]

Sign In for Pricing
View Details
Phospho-IRS1 (Tyr1179) Polyclonal Antibody
bs-8709R 100 µL

Phospho-IRS1 (Tyr1179) Polyclonal Antibody

Sign In for Pricing
View Details
Ebi3 Antibody
C30627-01 50 μL

Ebi3 Antibody

Sign In for Pricing
View Details