Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Versican Isoform V0, Human (His, B2M, Myc)

Versican Isoform V3 Protein, involved in intercellular signaling, connects cells to the extracellular matrix, regulating cell motility, growth, and differentiation. It binds hyaluronic acid and interacts with FBLN1. Versican Isoform V0 Protein, Human (His, B2M, Myc) is the recombinant human-derived Versican Isoform V0, expressed by E. coli, with N-B2M, C-Myc, N-10*His labeled tag.

Product Specifications

Product Name Alternative

Versican Isoform V0 Protein, Human (His, B2M, Myc), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/versican-isoform-v0-protein-human-sf9-his-myc.html

Purity

98.00

Smiles

GPDRCKMNPCLNGGTCYPTETSYVCTCVPGYSGDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMN

Molecular Formula

1462 (Gene_ID) P13611-1 (G3089-N3354) (Accession)

Molecular Weight

Approximately 50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Interleukin 34 Antibody (36W18) [DyLight 680]
NBP2-21982FR 0.1 mL

Mouse Monoclonal Interleukin 34 Antibody (36W18) [DyLight 680]

Sign In for Pricing
View Details
Slc5a11 (NM_001100482) Rat Untagged Clone
RN213280 10 µg

Slc5a11 (NM_001100482) Rat Untagged Clone

Sign In for Pricing
View Details
EGFR Rabbit Polyclonal Antibody
ES2235-01 50 µL

EGFR Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EGFR Rabbit Polyclonal Antibody
ES2235-02 100 µL

EGFR Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NMS (Neuromedin-S, NMS) (HRP)
MBS6457695-01 0.1 mL

NMS (Neuromedin-S, NMS) (HRP)

Sign In for Pricing
View Details
NMS (Neuromedin-S, NMS) (HRP)
MBS6457695-02 5x 0.1 mL

NMS (Neuromedin-S, NMS) (HRP)

Sign In for Pricing
View Details