Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Versican Isoform V0, Human (His, B2M, Myc)

Versican Isoform V3 Protein, involved in intercellular signaling, connects cells to the extracellular matrix, regulating cell motility, growth, and differentiation. It binds hyaluronic acid and interacts with FBLN1. Versican Isoform V0 Protein, Human (His, B2M, Myc) is the recombinant human-derived Versican Isoform V0, expressed by E. coli, with N-B2M, C-Myc, N-10*His labeled tag.

Product Specifications

Product Name Alternative

Versican Isoform V0 Protein, Human (His, B2M, Myc), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/versican-isoform-v0-protein-human-sf9-his-myc.html

Purity

98.00

Smiles

GPDRCKMNPCLNGGTCYPTETSYVCTCVPGYSGDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMN

Molecular Formula

1462 (Gene_ID) P13611-1 (G3089-N3354) (Accession)

Molecular Weight

Approximately 50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NCRNA00103 siRNA Oligos set (Human)
62541171 3x 5 nmol

NCRNA00103 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Lentiviral human CLEC14A shRNA (UAS) - Lentiviral human CLEC14A shRNA (UAS, GFP) plasmid
GTR15083854 1 Vial

Lentiviral human CLEC14A shRNA (UAS) - Lentiviral human CLEC14A shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
COL20A1 Antibody, FITC conjugated
A68590-100UG 100 µg

COL20A1 Antibody, FITC conjugated

Sign In for Pricing
View Details
ccr5 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV657947 1.0 µg DNA

ccr5 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Rabbit Polyclonal SPINK2 Antibody [PE]
NBP2-98568PE 0.1 mL

Rabbit Polyclonal SPINK2 Antibody [PE]

Sign In for Pricing
View Details
Rat Peroxisome Proliferator Activated Receptor Gamma Coactivator 1 Alpha, PPARgC1a, PCG-1a ELISA KIT
E2088Ra-01 48 Well

Rat Peroxisome Proliferator Activated Receptor Gamma Coactivator 1 Alpha, PPARgC1a, PCG-1a ELISA KIT

Sign In for Pricing
View Details