Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Versican Isoform V0, Human (His, B2M, Myc)

Versican Isoform V3 Protein, involved in intercellular signaling, connects cells to the extracellular matrix, regulating cell motility, growth, and differentiation. It binds hyaluronic acid and interacts with FBLN1. Versican Isoform V0 Protein, Human (His, B2M, Myc) is the recombinant human-derived Versican Isoform V0, expressed by E. coli, with N-B2M, C-Myc, N-10*His labeled tag.

Product Specifications

Product Name Alternative

Versican Isoform V0 Protein, Human (His, B2M, Myc), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/versican-isoform-v0-protein-human-sf9-his-myc.html

Purity

98.00

Smiles

GPDRCKMNPCLNGGTCYPTETSYVCTCVPGYSGDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMN

Molecular Formula

1462 (Gene_ID) P13611-1 (G3089-N3354) (Accession)

Molecular Weight

Approximately 50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Anti-Centrol And Centrosome Antibody IgM ELISA Kit
BG-HUM10230 1 Each

Human Anti-Centrol And Centrosome Antibody IgM ELISA Kit

Sign In for Pricing
View Details
Mmu-miR-3098-3p mimic
HY-R02983-01 5 nmol

Mmu-miR-3098-3p mimic

Sign In for Pricing
View Details
Mmu-miR-3098-3p mimic
HY-R02983-02 20 nmol

Mmu-miR-3098-3p mimic

Sign In for Pricing
View Details
D-Glucosamine hydrochloride
TB0100 8XX20mg

D-Glucosamine hydrochloride

Sign In for Pricing
View Details
RPL35AP8 CRISPR Knock Out 293T Cell Line (Human)
41522141 1x 10^6 Cells / 1.0 mL

RPL35AP8 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
SARS-CoV-2 RBD (E484K) Protein (C-His, Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) )
P508085 100 µg

SARS-CoV-2 RBD (E484K) Protein (C-His, Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) )

Sign In for Pricing
View Details