Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Versican Isoform V0, Human (His, B2M, Myc)

Versican Isoform V3 Protein, involved in intercellular signaling, connects cells to the extracellular matrix, regulating cell motility, growth, and differentiation. It binds hyaluronic acid and interacts with FBLN1. Versican Isoform V0 Protein, Human (His, B2M, Myc) is the recombinant human-derived Versican Isoform V0, expressed by E. coli, with N-B2M, C-Myc, N-10*His labeled tag.

Product Specifications

Product Name Alternative

Versican Isoform V0 Protein, Human (His, B2M, Myc), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/versican-isoform-v0-protein-human-sf9-his-myc.html

Purity

98.00

Smiles

GPDRCKMNPCLNGGTCYPTETSYVCTCVPGYSGDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMN

Molecular Formula

1462 (Gene_ID) P13611-1 (G3089-N3354) (Accession)

Molecular Weight

Approximately 50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-KIF22 antibody
STJ117480 100 µl

Anti-KIF22 antibody

Sign In for Pricing
View Details
EGLN3 (Egl Nine Homolog 3, HPH-1, Hypoxia-inducible Factor Prolyl Hydroxylase 3, HIF-PH3, HIF-prolyl Hydroxylase 3, HPH-3, Prolyl Hydroxylase Domain-containing Protein 3, FLJ21620, HIFPH3, MGC125998, MGC125999, PHD3) (HRP)
126205-HRP 100 µL

EGLN3 (Egl Nine Homolog 3, HPH-1, Hypoxia-inducible Factor Prolyl Hydroxylase 3, HIF-PH3, HIF-prolyl Hydroxylase 3, HPH-3, Prolyl Hydroxylase Domain-containing Protein 3, FLJ21620, HIFPH3, MGC125998, MGC125999, PHD3) (HRP)

Sign In for Pricing
View Details
SNX18P27 Recombinant Protein (Human)
RP099399 100 µg

SNX18P27 Recombinant Protein (Human)

Sign In for Pricing
View Details
Anti- Human /Mouse /Rat Full length Polyclonal Antibody
E53P07499 100 µL

Anti- Human /Mouse /Rat Full length Polyclonal Antibody

Sign In for Pricing
View Details
C1orf96 Polyclonal Antibody, PE Conjugated
bs-9796R-PE 100 µL

C1orf96 Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
TRIM24, NT (TRIM24, RNF82, TIF1, TIF1A, Transcription intermediary factor 1-alpha, E3 ubiquitin-protein ligase TRIM24, RING finger protein 82, Tripartite motif-containing protein 24) (Biotin) discontinued
043220-Biotin 200 µL

TRIM24, NT (TRIM24, RNF82, TIF1, TIF1A, Transcription intermediary factor 1-alpha, E3 ubiquitin-protein ligase TRIM24, RING finger protein 82, Tripartite motif-containing protein 24) (Biotin) discontinued

Sign In for Pricing
View Details