Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Versican Isoform V0, Human (His, B2M, Myc)

Versican Isoform V3 Protein, involved in intercellular signaling, connects cells to the extracellular matrix, regulating cell motility, growth, and differentiation. It binds hyaluronic acid and interacts with FBLN1. Versican Isoform V0 Protein, Human (His, B2M, Myc) is the recombinant human-derived Versican Isoform V0, expressed by E. coli, with N-B2M, C-Myc, N-10*His labeled tag.

Product Specifications

Product Name Alternative

Versican Isoform V0 Protein, Human (His, B2M, Myc), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/versican-isoform-v0-protein-human-sf9-his-myc.html

Purity

98.00

Smiles

GPDRCKMNPCLNGGTCYPTETSYVCTCVPGYSGDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMN

Molecular Formula

1462 (Gene_ID) P13611-1 (G3089-N3354) (Accession)

Molecular Weight

Approximately 50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GTPBP4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0919206 1.0 µg DNA

GTPBP4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Zc3h11a sgRNA CRISPR Lentivector (Rat) (Target 2)
K6507203 1.0 µg DNA

Zc3h11a sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Gm826 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3207408 1.0 µg DNA

Gm826 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
FAM69A (HRP)
562226-01 50 µg

FAM69A (HRP)

Sign In for Pricing
View Details
FAM69A (HRP)
562226-02 100 µg

FAM69A (HRP)

Sign In for Pricing
View Details
Box of 100 folded standard filter 64g/m², 100 mm
ST60P0100 Box of 100

Box of 100 folded standard filter 64g/m², 100 mm

Sign In for Pricing
View Details