Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Versican Isoform V0, Human (His, B2M, Myc)

Versican Isoform V3 Protein, involved in intercellular signaling, connects cells to the extracellular matrix, regulating cell motility, growth, and differentiation. It binds hyaluronic acid and interacts with FBLN1. Versican Isoform V0 Protein, Human (His, B2M, Myc) is the recombinant human-derived Versican Isoform V0, expressed by E. coli, with N-B2M, C-Myc, N-10*His labeled tag.

Product Specifications

Product Name Alternative

Versican Isoform V0 Protein, Human (His, B2M, Myc), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/versican-isoform-v0-protein-human-sf9-his-myc.html

Purity

98.00

Smiles

GPDRCKMNPCLNGGTCYPTETSYVCTCVPGYSGDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMN

Molecular Formula

1462 (Gene_ID) P13611-1 (G3089-N3354) (Accession)

Molecular Weight

Approximately 50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Huntingtin Antibody (6F2)
NBP3-26212-100ul 100 µL

Rabbit Monoclonal Huntingtin Antibody (6F2)

Sign In for Pricing
View Details
CD3 Rabbit Monoclonal Antibody
AMRe21534-01 50 µL

CD3 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CD3 Rabbit Monoclonal Antibody
AMRe21534-02 100 µL

CD3 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CD3 Rabbit Monoclonal Antibody
AMRe21534-03 200 µL

CD3 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
ZNF771 Adenovirus (Human)
51821051 1.0 mL

ZNF771 Adenovirus (Human)

Sign In for Pricing
View Details
Anti-Mouse TCR αβ/alpha-beta TCR Antibody (H57-597), PE
MP370227-01 1 Each

Anti-Mouse TCR αβ/alpha-beta TCR Antibody (H57-597), PE

Sign In for Pricing
View Details