Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Versican Isoform V0, Human (His, B2M, Myc)

Versican Isoform V3 Protein, involved in intercellular signaling, connects cells to the extracellular matrix, regulating cell motility, growth, and differentiation. It binds hyaluronic acid and interacts with FBLN1. Versican Isoform V0 Protein, Human (His, B2M, Myc) is the recombinant human-derived Versican Isoform V0, expressed by E. coli, with N-B2M, C-Myc, N-10*His labeled tag.

Product Specifications

Product Name Alternative

Versican Isoform V0 Protein, Human (His, B2M, Myc), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/versican-isoform-v0-protein-human-sf9-his-myc.html

Purity

98.00

Smiles

GPDRCKMNPCLNGGTCYPTETSYVCTCVPGYSGDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMN

Molecular Formula

1462 (Gene_ID) P13611-1 (G3089-N3354) (Accession)

Molecular Weight

Approximately 50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Oas1b (NM_001083925) Mouse Tagged ORF Clone Lentiviral Particle
MR220810L4V 200 µL

Oas1b (NM_001083925) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Oct-1 (12F11) Alexa Fluor® 546
sc-8024 AF546 200 µg/mL

Oct-1 (12F11) Alexa Fluor® 546

Sign In for Pricing
View Details
Recombinant Human Integral membrane protein GPR137C (GPR137C)
MBS7016087-01 0.02 mg

Recombinant Human Integral membrane protein GPR137C (GPR137C)

Sign In for Pricing
View Details
Recombinant Human Integral membrane protein GPR137C (GPR137C)
MBS7016087-02 0.1 mg

Recombinant Human Integral membrane protein GPR137C (GPR137C)

Sign In for Pricing
View Details
Recombinant Human Integral membrane protein GPR137C (GPR137C)
MBS7016087-03 5x 0.1 mg

Recombinant Human Integral membrane protein GPR137C (GPR137C)

Sign In for Pricing
View Details
Ssbp2 (NM_024186) Mouse Recombinant Protein
TP504874 20 µg

Ssbp2 (NM_024186) Mouse Recombinant Protein

Sign In for Pricing
View Details