Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Versican Isoform V0, Human (His, B2M, Myc)

Versican Isoform V3 Protein, involved in intercellular signaling, connects cells to the extracellular matrix, regulating cell motility, growth, and differentiation. It binds hyaluronic acid and interacts with FBLN1. Versican Isoform V0 Protein, Human (His, B2M, Myc) is the recombinant human-derived Versican Isoform V0, expressed by E. coli, with N-B2M, C-Myc, N-10*His labeled tag.

Product Specifications

Product Name Alternative

Versican Isoform V0 Protein, Human (His, B2M, Myc), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/versican-isoform-v0-protein-human-sf9-his-myc.html

Purity

98.00

Smiles

GPDRCKMNPCLNGGTCYPTETSYVCTCVPGYSGDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMN

Molecular Formula

1462 (Gene_ID) P13611-1 (G3089-N3354) (Accession)

Molecular Weight

Approximately 50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Tumor Necrosis Factor alpha  antibody
STJ16101140 1 mL

Anti-Tumor Necrosis Factor alpha antibody

Sign In for Pricing
View Details
Abhd15 (NM_026185) Mouse Tagged ORF Clone
MR215713 10 µg

Abhd15 (NM_026185) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
GPD1L (Glycerol-3-phosphate Dehydrogenase 1-like Protein, GPD1-L) discontinued
211062-01 50 µL

GPD1L (Glycerol-3-phosphate Dehydrogenase 1-like Protein, GPD1-L) discontinued

Sign In for Pricing
View Details
GPD1L (Glycerol-3-phosphate Dehydrogenase 1-like Protein, GPD1-L) discontinued
211062-02 100 µL

GPD1L (Glycerol-3-phosphate Dehydrogenase 1-like Protein, GPD1-L) discontinued

Sign In for Pricing
View Details
GPD1L (Glycerol-3-phosphate Dehydrogenase 1-like Protein, GPD1-L) discontinued
211062-03 200 µL

GPD1L (Glycerol-3-phosphate Dehydrogenase 1-like Protein, GPD1-L) discontinued

Sign In for Pricing
View Details
Cathepsin S (CTSS) Rabbit Polyclonal Antibody
TA343088 100 µL

Cathepsin S (CTSS) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details