Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Versican Isoform V0, Human (His, B2M, Myc)

Versican Isoform V3 Protein, involved in intercellular signaling, connects cells to the extracellular matrix, regulating cell motility, growth, and differentiation. It binds hyaluronic acid and interacts with FBLN1. Versican Isoform V0 Protein, Human (His, B2M, Myc) is the recombinant human-derived Versican Isoform V0, expressed by E. coli, with N-B2M, C-Myc, N-10*His labeled tag.

Product Specifications

Product Name Alternative

Versican Isoform V0 Protein, Human (His, B2M, Myc), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/versican-isoform-v0-protein-human-sf9-his-myc.html

Purity

98.00

Smiles

GPDRCKMNPCLNGGTCYPTETSYVCTCVPGYSGDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMN

Molecular Formula

1462 (Gene_ID) P13611-1 (G3089-N3354) (Accession)

Molecular Weight

Approximately 50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SLC25A6 shRNA Plasmid
abx950205-01 150 µg

Human SLC25A6 shRNA Plasmid

Sign In for Pricing
View Details
Human SLC25A6 shRNA Plasmid
abx950205-02 300 µg

Human SLC25A6 shRNA Plasmid

Sign In for Pricing
View Details
Lentiviral mouse Lrrc74b shRNA (UAS) - Lentiviral mouse Lrrc74b shRNA (UAS, GFP) (100)
GTR15204753 1 Vial

Lentiviral mouse Lrrc74b shRNA (UAS) - Lentiviral mouse Lrrc74b shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
SNX15 (Sorting Nexin-15, HSAF001435) (PE)
MBS6160420-01 0.1 mL

SNX15 (Sorting Nexin-15, HSAF001435) (PE)

Sign In for Pricing
View Details
SNX15 (Sorting Nexin-15, HSAF001435) (PE)
MBS6160420-02 5x 0.1 mL

SNX15 (Sorting Nexin-15, HSAF001435) (PE)

Sign In for Pricing
View Details
Membrane Spanning 4 Domains Subfamily A, Member 1
548651 200 µL

Membrane Spanning 4 Domains Subfamily A, Member 1

Sign In for Pricing
View Details