TNF RI/TNFRSF1A, Human (CHO)
TNFRSF1A (TNF RI) protein has a high ability to bind with tumor necrosis factor-alpha (TNF-α) . TNFRSF1A is a STAT3 target gene that regulates the NF-κB pathway. TNFRSF1A activate NF-κB, mediate apoptosis, and function as a regulator of inflammation. TNFRSF1A Protein, Human (CHO) is expressed by CHO and has a transmembrane region (D41-N201) [1].
Product Specifications
Product Name Alternative
TNF RI/TNFRSF1A Protein, Human (CHO), Human, CHO
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/tnfrsf1a-protein-human-cho.html
Purity
95.0
Smiles
DSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIEN
Molecular Formula
7132 (Gene_ID) P19438-1 (D41-N201) (Accession)
Molecular Weight
28-35 kDa
References & Citations
[1]Palladino MA, et al. Anti-TNF-alpha therapies: the next generation. Nat Rev Drug Discov. 2003 Sep;2 (9) :736-46.|[2]Wajant H, et, al. Tumor necrosis factor signaling. Cell Death Differ. 2003 Jan;10 (1) :45-65.|[3]Fu Q, et, al. miR-29a up-regulation in AR42J cells contributes to apoptosis via targeting TNFRSF1A gene. World J Gastroenterol. 2016 May 28;22 (20) :4881-90.|[4]Zhou S, et, al. Bioinformatics Analysis Identifies TNFRSF1A as a Biomarker of Liver Injury in Sepsis TNFRSF1A is a Biomarker for Septic Liver Injury. Genet Res (Camb) . 2022 Oct 15;2022:1493744.|[5]Egusquiaguirre SP, et, al. The STAT3 Target Gene TNFRSF1A Modulates the NF-κB Pathway in Breast Cancer Cells. Neoplasia. 2018 May;20 (5) :489-498.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
A23102-5000 5000 mg
N-[ (1,1-Dimethylethoxy) carbonyl]-L-leucyl-L-leucine 5000mg
Sign In for Pricing
View Details