Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EGLP/GPX5, Pig (P.pastoris, Myc, His)

EGLP/GPX5 may constitute a protective system similar to glutathione peroxidase, protecting sperm membrane lipids from peroxidative damage. Despite the limited enzyme activity, the protective effect suggests an effect beyond enzyme function. EGLP/GPX5 Protein, Pig (P.pastoris, Myc, His) is the recombinant pig-derived EGLP/GPX5 protein, expressed by P. pastoris , with N-His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

EGLP/GPX5 Protein, Pig (P.pastoris, Myc, His), Pig, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/eglp-gpx5-protein-pig-p-pastoris-myc-his.html

Purity

97.0

Smiles

NSNLEKMDCYKDVTGTIYDYDAFTLNGNEHIQFKQYAGKHVLFVNVATYCGLTAQYPELNTLQEELKPFGLVVLGFPCNQFGKQEPGENSEILLGLKYVRPGGGYVPNFQLFEKGDVNGEKEQKVFTFLKHSCPHPSELIGSIGYISWEPIRVHDIRWNFEKFLVGPDGVPVMRWVHETPISTVKSDILAYLKQFKTE

Molecular Formula

396920 (Gene_ID) O18994 (N22-E219) (Accession)

Molecular Weight

Approximately 26.1 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGE A1 (MA454), CF647 conjugate, 0.1mg/mL
BNC470008-100 1x 100 µL

MAGE A1 (MA454), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF640R conjugate, 0.1mg/mL
BNC402853-500 1x 500 µL

CD54 / ICAM-1 (15.2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nucleolin (364-5 + NCL/902), CF740 conjugate, 0.1mg/mL
BNC741205-500 1x 500 µL

Nucleolin (364-5 + NCL/902), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (T-Cell Marker) (rSPN/1094), CF640R conjugate, 0.1mg/mL
BNC401858-100 1x 100 µL

CD43 (T-Cell Marker) (rSPN/1094), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/2338R), CF640R conjugate, 0.1mg/mL
BNC402338-500 1x 500 µL

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/2338R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD137, Mouse (LOB12), CF488A conjugate, 0.1mg/mL
BNC882012-500 1x 500 µL

CD137, Mouse (LOB12), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details