Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EGLP/GPX5, Pig (P.pastoris, Myc, His)

EGLP/GPX5 may constitute a protective system similar to glutathione peroxidase, protecting sperm membrane lipids from peroxidative damage. Despite the limited enzyme activity, the protective effect suggests an effect beyond enzyme function. EGLP/GPX5 Protein, Pig (P.pastoris, Myc, His) is the recombinant pig-derived EGLP/GPX5 protein, expressed by P. pastoris , with N-His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

EGLP/GPX5 Protein, Pig (P.pastoris, Myc, His), Pig, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/eglp-gpx5-protein-pig-p-pastoris-myc-his.html

Purity

97.0

Smiles

NSNLEKMDCYKDVTGTIYDYDAFTLNGNEHIQFKQYAGKHVLFVNVATYCGLTAQYPELNTLQEELKPFGLVVLGFPCNQFGKQEPGENSEILLGLKYVRPGGGYVPNFQLFEKGDVNGEKEQKVFTFLKHSCPHPSELIGSIGYISWEPIRVHDIRWNFEKFLVGPDGVPVMRWVHETPISTVKSDILAYLKQFKTE

Molecular Formula

396920 (Gene_ID) O18994 (N22-E219) (Accession)

Molecular Weight

Approximately 26.1 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pigx (NM_001100651) Rat Untagged Clone
RN202628 10 µg

Pigx (NM_001100651) Rat Untagged Clone

Sign In for Pricing
View Details
MRP-L1 Double Nickase Plasmid (m2)
sc-430098-NIC-2 20 µg

MRP-L1 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Cytochrome P450 2C9 (CYP2C9) (NM_000771) Human Tagged ORF Clone
RG220997 10 µg

Cytochrome P450 2C9 (CYP2C9) (NM_000771) Human Tagged ORF Clone

Sign In for Pricing
View Details
NUP62 Protein Vector (Mouse) (pPB-C-His)
PV207346 500 ng

NUP62 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Anti-TRIM39 Antibody Picoband® FITC Conjugated
A09149-1-FITC 100 µg/Vial

Anti-TRIM39 Antibody Picoband® FITC Conjugated

Sign In for Pricing
View Details
Human Ras-related protein Rab-5B (RAB5B) ELISA Kit
abx541186 96 Tests

Human Ras-related protein Rab-5B (RAB5B) ELISA Kit

Sign In for Pricing
View Details