Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Dipeptidyl peptidase 1 (Ctsc), partial

Product Specifications

Product Name Alternative

(Cathepsin C) (Cathepsin J) (Dipeptidyl peptidase I) (DPP-I) (DPPI) (Dipeptidyl transferase) (Dipeptidyl peptidase I exclusion domain chain) (Dipeptidyl peptidase I heavy chain) (Dipeptidyl peptidase I light chain)

Abbreviation

Recombinant Mouse Ctsc protein, partial

Gene Name

Ctsc

UniProt

P97821

Expression Region

25-134aa

Organism

Mus musculus (Mouse)

Target Sequence

DTPANCTYPDLLGTWVFQVGPRSSRSDINCSVMEATEEKVVVHLKKLDTAYDELGNSGHFTLIYNQGFEIVLNDYKWFAFFKYEVRGHTAISYCHETMTGWVHDVLGRNW

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Thiol protease. Has dipeptidylpeptidase activity. Can act as both an exopeptidase and endopeptidase. Can degrade glucagon. Plays a role in the generation of cytotoxic lymphocyte effector function.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

20.1 kDa

References & Citations

"A tissue-specific atlas of mouse protein phosphorylation and expression." Huttlin E.L., Jedrychowski M.P., Elias J.E., Goswami T., Rad R., Beausoleil S.A., Villen J., Haas W., Sowa M.E., Gygi S.P. Cell 143:1174-1189 (2010)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Trifluoroacetamido-1,4-di-p-nitrobenzoyl Daunosamine
TRC-T781500-10MG 10 mg

N-Trifluoroacetamido-1,4-di-p-nitrobenzoyl Daunosamine

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18) (KRT18/2808R), CF405S conjugate, 0.1mg/mL
BNC042808-500 1x 500 µL

Cytokeratin 18 (KRT18) (KRT18/2808R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SIX1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H4]
TA504057BM 100 µL

SIX1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H4]

Sign In for Pricing
View Details
VNN1 (NM_004666) Human Over-expression Lysate
LC401479 20 µg

VNN1 (NM_004666) Human Over-expression Lysate

Sign In for Pricing
View Details
ARHGAP25 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D5]
TA501717AM 100 µL

ARHGAP25 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D5]

Sign In for Pricing
View Details
Human IPMK activation kit by CRISPRa
GA116744 1 Kit

Human IPMK activation kit by CRISPRa

Sign In for Pricing
View Details