Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRSF1, Human (His-SUMO)

The SRSF1 protein plays a crucial role in splicing regulation, preventing exon skipping and ensuring splicing accuracy. It interacts with spliceosome components and forms a bridge between 5'- and 3'-splice site binding elements. SRSF1 Protein, Human (His-SUMO) is the recombinant human-derived SRSF1 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

SRSF1 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/srsf1-protein-human-his-sumo.html

Purity

96.00

Smiles

SGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSRSRSRSRSRSNSRSRSYSPRRSRGSPRYSPRHSRSRSRT

Molecular Formula

6426 (Gene_ID) Q07955-1 (S2-T248) (Accession)

Molecular Weight

Approximately 43 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Defluoro Hydroxy AM-694
TRC-D228730-5MG 5 mg

Defluoro Hydroxy AM-694

Sign In for Pricing
View Details
Cathepsin D (Tumor Marker) (CTSD/3082), CF647 conjugate, 0.1mg/mL
BNC473082-500 1x 500 µL

Cathepsin D (Tumor Marker) (CTSD/3082), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chk1 (Ab-317) Antibody
8B7041-AAT 50 µg

Chk1 (Ab-317) Antibody

Sign In for Pricing
View Details
KCTD9 Mouse Monoclonal Antibody [Clone ID: OTI3A2]
CF807765 100 µg

KCTD9 Mouse Monoclonal Antibody [Clone ID: OTI3A2]

Sign In for Pricing
View Details
LOX (Center) Rabbit Polyclonal Antibody
AP52513PU-N 400 µL

LOX (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
UPB1 (NM_016327) Human Recombinant Protein
TP720186M 50 µg

UPB1 (NM_016327) Human Recombinant Protein

Sign In for Pricing
View Details