Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRSF1, Human (His-SUMO)

The SRSF1 protein plays a crucial role in splicing regulation, preventing exon skipping and ensuring splicing accuracy. It interacts with spliceosome components and forms a bridge between 5'- and 3'-splice site binding elements. SRSF1 Protein, Human (His-SUMO) is the recombinant human-derived SRSF1 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

SRSF1 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/srsf1-protein-human-his-sumo.html

Purity

96.00

Smiles

SGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSRSRSRSRSRSNSRSRSYSPRRSRGSPRYSPRHSRSRSRT

Molecular Formula

6426 (Gene_ID) Q07955-1 (S2-T248) (Accession)

Molecular Weight

Approximately 43 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pik3ca Mouse Gene Knockout Kit (CRISPR)
KN313294LP 1 Kit

Pik3ca Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Aquaporin 5 (AQP5) (NM_001651) Human Over-expression Lysate
LC400622 20 µg

Aquaporin 5 (AQP5) (NM_001651) Human Over-expression Lysate

Sign In for Pricing
View Details
SEMA6C Antibody
KC-7600-01 50 μL

SEMA6C Antibody

Sign In for Pricing
View Details
SEMA6C Antibody
KC-7600-02 100 µL

SEMA6C Antibody

Sign In for Pricing
View Details
SEMA6C Antibody
KC-7600-03 1 mL

SEMA6C Antibody

Sign In for Pricing
View Details
Asiaticoside
TRC-A788210-25MG 25 mg

Asiaticoside

Sign In for Pricing
View Details