Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRSF1, Human (His-SUMO)

The SRSF1 protein plays a crucial role in splicing regulation, preventing exon skipping and ensuring splicing accuracy. It interacts with spliceosome components and forms a bridge between 5'- and 3'-splice site binding elements. SRSF1 Protein, Human (His-SUMO) is the recombinant human-derived SRSF1 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

SRSF1 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/srsf1-protein-human-his-sumo.html

Purity

96.00

Smiles

SGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSRSRSRSRSRSNSRSRSYSPRRSRGSPRYSPRHSRSRSRT

Molecular Formula

6426 (Gene_ID) Q07955-1 (S2-T248) (Accession)

Molecular Weight

Approximately 43 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD68 (CD68/G2), CF647 conjugate, 0.1mg/mL
BNC470919-500 1x 500 µL

CD68 (CD68/G2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NOL4 (NM_001198547) Human Over-expression Lysate
LC434314 20 µg

NOL4 (NM_001198547) Human Over-expression Lysate

Sign In for Pricing
View Details
Pure Phytolacca americana Lectin (Pokeweed) -PWMPWA-
L-1901-5 5 mg

Pure Phytolacca americana Lectin (Pokeweed) -PWMPWA-

Sign In for Pricing
View Details
3-epi-Ochratoxin A-d5
TRC-O148497-5MG 5 mg

3-epi-Ochratoxin A-d5

Sign In for Pricing
View Details
Rat TNFRSF9 Antibody Pair Set
E-KAB-0634 50 µL & 100 µg

Rat TNFRSF9 Antibody Pair Set

Sign In for Pricing
View Details
TCF23 (NM_175769) Human Recombinant Protein
TP321910M 100 µg

TCF23 (NM_175769) Human Recombinant Protein

Sign In for Pricing
View Details