Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRSF1, Human (His-SUMO)

The SRSF1 protein plays a crucial role in splicing regulation, preventing exon skipping and ensuring splicing accuracy. It interacts with spliceosome components and forms a bridge between 5'- and 3'-splice site binding elements. SRSF1 Protein, Human (His-SUMO) is the recombinant human-derived SRSF1 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

SRSF1 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/srsf1-protein-human-his-sumo.html

Purity

96.00

Smiles

SGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSRSRSRSRSRSNSRSRSYSPRRSRGSPRYSPRHSRSRSRT

Molecular Formula

6426 (Gene_ID) Q07955-1 (S2-T248) (Accession)

Molecular Weight

Approximately 43 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Habp2 AAV siRNA Pooled Vector
22983164 1.0 µg

Habp2 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Conjugated NIT1 Rabbit mAb
C57305 100 µL

Conjugated NIT1 Rabbit mAb

Sign In for Pricing
View Details
TMTSP Double Nickase Plasmid (m)
sc-425051-NIC 20 µg

TMTSP Double Nickase Plasmid (m)

Sign In for Pricing
View Details
USP17L2 Peptide - middle region
orb2008498 100 µg

USP17L2 Peptide - middle region

Sign In for Pricing
View Details
Anti-CD71 / Transferrin Receptor (TFRC) (Extracellular Domain) Monoclonal Antibody (Clone: TFRC/1817)
36-3240-100 100 µg

Anti-CD71 / Transferrin Receptor (TFRC) (Extracellular Domain) Monoclonal Antibody (Clone: TFRC/1817)

Sign In for Pricing
View Details
Human Signal Transducer And Activator Of Transcription 3 (STAT3) ELISA Kit
RDR-STAT3-Hu-01 96 Tests

Human Signal Transducer And Activator Of Transcription 3 (STAT3) ELISA Kit

Sign In for Pricing
View Details