Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BAMBI/NMA, Mouse (HEK293, His)

Product Specifications

Product Name Alternative

HEK293

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bambi-nma-protein-mouse-hek293-his.html

Purity

97.00

Smiles

EIRCYCDAAHCVATGYMCKSELSACFSRLLDPQNTNSPLTHGCLDSLASTADICRAKQAQNHSGPAMPTLECCHEDMCNYRGLHDVLSPSKSEASGQGNRYQHDSSRNLITKMQELTSSKELWFRA

Molecular Weight

Approximately 19-24 kDa due to the glycosylation

Shipping Conditions

Blue Ice

Storage Conditions

Stored at -20°C for 2 years

More Discoveries

Explore Other Products

Browse additional items from our catalog

U2SURP sgRNA CRISPR Lentivector set (Human)
K2815901 3x 1.0 µg

U2SURP sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
DMRT2 (Doublesex-and mab-3-Related Transcription Factor 2, Doublesex-like 2 Protein, DSXL-2, DMRT2, DSXL2) (AP)
MBS6455535-01 0.1 mL

DMRT2 (Doublesex-and mab-3-Related Transcription Factor 2, Doublesex-like 2 Protein, DSXL-2, DMRT2, DSXL2) (AP)

Sign In for Pricing
View Details
DMRT2 (Doublesex-and mab-3-Related Transcription Factor 2, Doublesex-like 2 Protein, DSXL-2, DMRT2, DSXL2) (AP)
MBS6455535-02 5x 0.1 mL

DMRT2 (Doublesex-and mab-3-Related Transcription Factor 2, Doublesex-like 2 Protein, DSXL-2, DMRT2, DSXL2) (AP)

Sign In for Pricing
View Details
AGTRAP Protein Vector (Mouse) (pPB-N-His)
PV153139 500 ng

AGTRAP Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
C2orf48 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0224308 1.0 µg DNA

C2orf48 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Anti-PPBP,NAP2 antibody
PAab06668 100 µg

Anti-PPBP,NAP2 antibody

Sign In for Pricing
View Details