Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFN-lambda 3/IL-28B, Human (HEK293, His)

IFN-lambda 3 (IL-28B) is a member of the Type-III interferon family. IFN-lambda 3 has high similar 96% sequence identity with IFN-lambda 2 at the amino acid level. IFN-lambda 2 has antiviral antitumour and immunomodulatory activities[1]. IFN-lambda 2 signals through a heterodimeric receptor complex comprising IFNLR1 and IL-10RB. When binding to the receptor complex, Jak1 and Tyk2 will be activated, and leads to tyrosine phosphorylation of the IFN-λR1 and activation of STAT1 and STAT2. Activated STAT1 and STAT2 together with IRF-9 form a trimeric transcription factor complex (ISGF3) . The formed ISGF3 then translocate to the nucleus and promotes the production of IFN-stimulated genes (ISGs) [2]. IFN-lambda 3/IL-28B Protein, Human (HEK293, His) is a recombinant human IFN-lambda 3 (V22-V196) with C-terminal 6*His tag, which is expressed in HEK293.

Product Specifications

Product Name Alternative

IFN-lambda 3/IL-28B Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ifn-lambda-3-il-28b-protein-human-hek293-his.html

Purity

95.0

Smiles

VPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV

Molecular Formula

282617 (Gene_ID) Q8IZI9 (V22-V196) (Accession)

Molecular Weight

Approximately 22 kDa

References & Citations

[1]Lopušná K, et al. Interferons lambda, new cytokines with antiviral activity. Acta Virol. 2013;57 (2) :171-9.|[2]Donnelly RP, et al. Interferon-lambda: a new addition to an old family. J Interferon Cytokine Res. 2010 Aug;30 (8) :555-64.|[3]Witte K, et al. IL-28A, IL-28B, and IL-29: promising cytokines with type I interferon-like properties. Cytokine Growth Factor Rev. 2010 Aug;21 (4) :237-51. |[4]Metwally M, et al. IFNL3 genotype is associated with pulmonary fibrosis in patients with systemic sclerosis. Sci Rep. 2019 Oct 16;9 (1) :14834.|[5]Egli A, et al. IL-28B is a key regulator of B- and T-cell vaccine responses against influenza. PLoS Pathog. 2014 Dec 11;10 (12) :e1004556. |[6]Cheng M, et al. Recombinant human interleukin 28B: anti-HCV potency, receptor usage and restricted cell-type responsiveness. J Antimicrob Chemother. 2012 May;67 (5) :1080-7.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

KRT18 Rabbit Polyclonal Antibody
E53P06699 100 µL

KRT18 Rabbit Polyclonal Antibody

Ask
View Details
Human STEAP1 siRNA
abx935431-01 15 nmol

Human STEAP1 siRNA

Ask
View Details
Human STEAP1 siRNA
abx935431-02 30 nmol

Human STEAP1 siRNA

Ask
View Details
Mouse DCBLD1 shRNA Plasmid
abx975741-01 150 µg

Mouse DCBLD1 shRNA Plasmid

Ask
View Details
Mouse DCBLD1 shRNA Plasmid
abx975741-02 300 µg

Mouse DCBLD1 shRNA Plasmid

Ask
View Details
TTC8 (NM_144596) Human 3' UTR Clone
SC208250 10 µg

TTC8 (NM_144596) Human 3' UTR Clone

Ask
View Details