Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cystatin-F (Cst7)

Product Specifications

Product Name Alternative

Cystatin-7 (Cystatin-like metastasis-associated protein) (CMAP) (Leukocystatin)

Abbreviation

Recombinant Mouse Cst7 protein

Gene Name

Cst7

UniProt

O89098

Expression Region

19-144aa

Organism

Mus musculus (Mouse)

Target Sequence

ARPPDFCSKDLISSVKPGFPKTIETNNPGVLKAARHSVEKFNNCTNDIFLFKESHVSKALVQVVKGLKYMLEVKIGRTTCRKTMHHQLDNCDFQTNPALKRTLYCYSEVWVIPWLHSFEVPVLLCQ

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

Inhibits papain and cathepsin L but with affinities lower than other cystatins. May play a role in immune regulation through inhibition of a unique target in the hematopoietic system.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

20.5 kDa

References & Citations

"Functional annotation of a full-length mouse cDNA collection." Kawai J., Shinagawa A., Shibata K., Yoshino M., Itoh M., Ishii Y., Arakawa T., Hara A., Fukunishi Y., Konno H., Adachi J., Fukuda S., Aizawa K., Izawa M., Nishi K., Kiyosawa H., Kondo S., Yamanaka I. Hayashizaki Y. Nature 409:685-690 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LATS1/2(Phospho Thr1079/1041) Polyclonal Antibody
JOT-AP10852-01 50ul

LATS1/2(Phospho Thr1079/1041) Polyclonal Antibody

Sign In for Pricing
View Details
LATS1/2(Phospho Thr1079/1041) Polyclonal Antibody
JOT-AP10852-02 100ul

LATS1/2(Phospho Thr1079/1041) Polyclonal Antibody

Sign In for Pricing
View Details
RN5S195 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV743955 1.0 µg DNA

RN5S195 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Human CCDC18 knockout cell line
ABC-KH2513 1 Vial

Human CCDC18 knockout cell line

Sign In for Pricing
View Details
Rat LIFR Matched Antibody Pair Set [ABP-S-031450]
ABP-S-031450 5 Plates

Rat LIFR Matched Antibody Pair Set [ABP-S-031450]

Sign In for Pricing
View Details
Ethosuximide
C17516 500 mg

Ethosuximide

Sign In for Pricing
View Details