Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NKG2D/CD314, Human (HEK293, His)

The NKG2D/CD314 protein serves as a key activating and costimulatory receptor in immune surveillance, binding to multiple stress-inducing ligands on tumor and virus-infected cells.It plays a dual role by stimulating NK cells and enhancing T cell activation in CD8 (+) T cell-mediated adaptive responses.NKG2D/CD314 Protein, Human (HEK293, His) is the recombinant human-derived NKG2D/CD314 protein, expressed by HEK293 , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

NKG2D/CD314 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nkg2d-klrk1-protein-human-hek-293-his.html

Purity

98.0

Smiles

FLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV

Molecular Formula

22914 (Gene_ID) P26718 (F78-V216) (Accession)

Molecular Weight

20-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Fatty Acid Binding Protein 1, Liver (FABP1) ELISA Kit
orb777776-01 48 Tests

Human Fatty Acid Binding Protein 1, Liver (FABP1) ELISA Kit

Sign In for Pricing
View Details
Human Fatty Acid Binding Protein 1, Liver (FABP1) ELISA Kit
orb777776-02 96 Tests

Human Fatty Acid Binding Protein 1, Liver (FABP1) ELISA Kit

Sign In for Pricing
View Details
Male Germ Cell RacGap (MGCRACGAP) Antibody
abx134927-01 30 µL

Male Germ Cell RacGap (MGCRACGAP) Antibody

Sign In for Pricing
View Details
Male Germ Cell RacGap (MGCRACGAP) Antibody
abx134927-02 100 µL

Male Germ Cell RacGap (MGCRACGAP) Antibody

Sign In for Pricing
View Details
Male Germ Cell RacGap (MGCRACGAP) Antibody
abx134927-03 200 µL

Male Germ Cell RacGap (MGCRACGAP) Antibody

Sign In for Pricing
View Details
DOK7 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-13633R-BF488 100 µL

DOK7 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details