Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UDP-glucose 4-epimerase/GALE, Human (His)

GALE proteins catalyze the reversible epimerization of UDP-glucose to UDP-galactose, and the reversible epimerization of UDP-N-acetylglucosamine to UDP-N-acetylgalactosamine. UDP-glucose 4-epimerase/GALE Protein, Human (His) is the recombinant human-derived UDP-glucose 4-epimerase/GALE protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

UDP-glucose 4-epimerase/GALE Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/udp-glucose-4-epimerase-gale-protein-human-his.html

Purity

98.0

Smiles

MAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA

Molecular Formula

2582 (Gene_ID) Q14376-1 (M1-A348) (Accession)

Molecular Weight

Approximately 38.23 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNNI3 Recombinant Antibody, PE-Cy5 Conjugated
bsm-61955R-PE-Cy5 100 µL

TNNI3 Recombinant Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
HPRT1 Antibody (N-term)
orb1429595-01 50 µL

HPRT1 Antibody (N-term)

Sign In for Pricing
View Details
HPRT1 Antibody (N-term)
orb1429595-02 100 µL

HPRT1 Antibody (N-term)

Sign In for Pricing
View Details
St3gal4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7200206 1.0 µg DNA

St3gal4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Recombinant Human MMP2 protein (His tag)
MBS2571383-01 0.02 mg

Recombinant Human MMP2 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human MMP2 protein (His tag)
MBS2571383-02 0.1 mg

Recombinant Human MMP2 protein (His tag)

Sign In for Pricing
View Details