Animal-Free IL-25/IL-17E, Mouse (His)

MVSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPLGNSVPLYHNQTVFYRRPCHGEEGTHRRYCLERRLYRVSLACVCVRPRVMA

[1]Borowczyk J, et al. IL-25 (IL-17E) in epithelial immunology and pathophysiology. J Allergy Clin Immunol. 2021 Jul;148 (1) :40-52.|[2]Roan F, et al. Epithelial cell-derived cytokines: more than just signaling the alarm. J Clin Invest. 2019 Apr 1;129 (4) :1441-1451.|[3]Owyang AM, et al. Interleukin 25 regulates type 2 cytokine-dependent immunity and limits chronic inflammation in the gastrointestinal tract. J Exp Med. 2006 Apr 17;203 (4) :843-9.|[4]Angkasekwinai P, et al. Interleukin 25 promotes the initiation of proallergic type 2 responses. J Exp Med. 2007 Jul 9;204 (7) :1509-17.|[5]Xu M, et al. IL-25 in allergic inflammation. Immunol Rev. 2017 Jul;278 (1) :185-191.|[6]Monin L, et al. Interleukin 17 Family Cytokines: Signaling Mechanisms, Biological Activities, and Therapeutic Implications. Cold Spring Harb Perspect Biol. 2018 Apr 2;10 (4) :a028522.|[7]Rickel EA, et al. Identification of functional roles for both IL-17RB and IL-17RA in mediating IL-25-induced activities. J Immunol. 2008 Sep 15;181 (6) :4299-310.|[8]Fort MM, et al. IL-25 induces IL-4, IL-5, and IL-13 and Th2-associated pathologies in vivo. Immunity. 2001 Dec;15 (6) :985-95.|[9]Maezawa Y, et al. Involvement of TNF receptor-associated factor 6 in IL-25 receptor signaling. J Immunol. 2006 Jan 15;176 (2) :1013-8.|[10]Xu M, et al. An Interleukin-25-Mediated Autoregulatory Circuit in Keratinocytes Plays a Pivotal Role in Psoriatic Skin Inflammation. Immunity. 2018 Apr 17;48 (4) :787-798.e4.|[11]Borowczyk J, et al. IL-17E (IL-25) and IL-17A Differentially Affect the Functions of Human Keratinocytes. J Invest Dermatol. 2020 Jul;140 (7) :1379-1389.e2.|[12]Huang CK, et al. Autocrine/paracrine mechanism of interleukin-17B receptor promotes breast tumorigenesis through NF-κ B-mediated antiapoptotic pathway. Oncogene. 2014 Jun 5;33 (23) :2968-77.|[13]Cheung PF, et al. IL-25 regulates the expression of adhesion molecules on eosinophils: mechanism of eosinophilia in allergic inflammation. Allergy. 2006 Jul;61 (7) :878-85.|[14]Luo Y, Yet al. Non-CSCs nourish CSCs through interleukin-17E-mediated activation of NF-κ B and JAK/STAT3 signaling in human hepatocellular carcinoma. Cancer Lett. 2016 Jun 1;375 (2) :390-399.