Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-27, Mouse (HEK293, His, solution)

The IL-27 protein together with IL23A forms IL-23 interleukin, a key cytokine in innate and adaptive immunity. It is associated with infection responses, binds to IL12RB1 and IL23R receptor complexes, and activates Jak-Stat signaling. IL-27 Protein, Mouse (228a.a, HEK293, His, solution) is the recombinant mouse-derived IL-27, expressed by HEK293, with C-10*His labeled tag.

Product Specifications

Product Name Alternative

IL-27 Protein, Mouse (HEK293, His, solution), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-27-protein-mouse-228a-a-hek293-his-solution.html

Purity

95.00

Smiles

YTETALVALSQPRVQCHASRYPVAVDCSWTPLQAPNSTRSTSFIATYRLGVATQQQSQPCLQRSPQASRCTIPDVHLFSTVPYMLNVTAVHPGGASSSLLAFVAERIIKPDPPEGVRLRTAGQRLQVLWHPPASWPFPDIFSLKYRLRYRRRGASHFRQVGPIEATTFTLRNSKPHAKYCIQVSAQDLTDYGKPSDWSLPGQVESAPHKPGSGSGGSGGSGSGKLFPTDPLSLQELRREFTVSLYLARKLLSEVQGYVHSFAESRLPGVNLDLLPLGYHLPNVSLTFQAWHHLSDSERLCFLATTLRPFPAMLGGLGTQGTWTSSEREQLWAMRLDLRDLHRHLRFQVLAAGFKCSKEEEDKEEEEEEEEEEKKLPLGALGGPNQVSSQVSWPQLLYTYQLLHSLELVLSRAVRDLLLLSLPRRPGSAWDS

Molecular Formula

50498&246779 (Gene_ID) O35228 (Y19-P228) &GSGSGGSGGSGSGKL &Q8K3I6 (F29-S234) (Accession)

Molecular Weight

Approximately 60 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PerCP/Cyanine5.5 Anti-Mouse CD45 Antibody[I3/2.3]
AN00630J-01 50 Tests

PerCP/Cyanine5.5 Anti-Mouse CD45 Antibody[I3/2.3]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse CD45 Antibody[I3/2.3]
AN00630J-02 100 Tests

PerCP/Cyanine5.5 Anti-Mouse CD45 Antibody[I3/2.3]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse CD45 Antibody[I3/2.3]
AN00630J-03 2x 100 Tests

PerCP/Cyanine5.5 Anti-Mouse CD45 Antibody[I3/2.3]

Sign In for Pricing
View Details
ACSL5 (NM_203380) Human Over-expression Lysate
LC404322 20 µg

ACSL5 (NM_203380) Human Over-expression Lysate

Sign In for Pricing
View Details
PDGF Receptor alpha (PDGFRA) (NM_006206) Human Recombinant Protein
TP311740M 100 µg

PDGF Receptor alpha (PDGFRA) (NM_006206) Human Recombinant Protein

Sign In for Pricing
View Details
Isobergapten
TRC-I778875-5MG 5 mg

Isobergapten

Sign In for Pricing
View Details