Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-27, Mouse (HEK293, His, solution)

The IL-27 protein together with IL23A forms IL-23 interleukin, a key cytokine in innate and adaptive immunity. It is associated with infection responses, binds to IL12RB1 and IL23R receptor complexes, and activates Jak-Stat signaling. IL-27 Protein, Mouse (228a.a, HEK293, His, solution) is the recombinant mouse-derived IL-27, expressed by HEK293, with C-10*His labeled tag.

Product Specifications

Product Name Alternative

IL-27 Protein, Mouse (HEK293, His, solution), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-27-protein-mouse-228a-a-hek293-his-solution.html

Purity

95.00

Smiles

YTETALVALSQPRVQCHASRYPVAVDCSWTPLQAPNSTRSTSFIATYRLGVATQQQSQPCLQRSPQASRCTIPDVHLFSTVPYMLNVTAVHPGGASSSLLAFVAERIIKPDPPEGVRLRTAGQRLQVLWHPPASWPFPDIFSLKYRLRYRRRGASHFRQVGPIEATTFTLRNSKPHAKYCIQVSAQDLTDYGKPSDWSLPGQVESAPHKPGSGSGGSGGSGSGKLFPTDPLSLQELRREFTVSLYLARKLLSEVQGYVHSFAESRLPGVNLDLLPLGYHLPNVSLTFQAWHHLSDSERLCFLATTLRPFPAMLGGLGTQGTWTSSEREQLWAMRLDLRDLHRHLRFQVLAAGFKCSKEEEDKEEEEEEEEEEKKLPLGALGGPNQVSSQVSWPQLLYTYQLLHSLELVLSRAVRDLLLLSLPRRPGSAWDS

Molecular Formula

50498&246779 (Gene_ID) O35228 (Y19-P228) &GSGSGGSGGSGSGKL &Q8K3I6 (F29-S234) (Accession)

Molecular Weight

Approximately 60 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sucrose-1,1,6,6,6’,6’-d6
TRC-S697002-5MG 5 mg

Sucrose-1,1,6,6,6’,6’-d6

Sign In for Pricing
View Details
Thyroglobulin (Thyroidal Cell Marker) (r2H11), CF594 conjugate, 0.1mg/mL
BNC942161-100 1x 100 µL

Thyroglobulin (Thyroidal Cell Marker) (r2H11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cathepsin D (Tumor Marker) (CTSD/3082), CF568 conjugate, 0.1mg/mL
BNC683082-500 1x 500 µL

Cathepsin D (Tumor Marker) (CTSD/3082), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Alkaline Phosphatase (Placental) / PLAP (Germ Cell Tumor Marker) (ALPP/2899R), CF740 conjugate, 0.1mg/mL
BNC742899-100 1x 100 µL

Alkaline Phosphatase (Placental) / PLAP (Germ Cell Tumor Marker) (ALPP/2899R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GCKR Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9G7]
TA502163AM 100 µL

GCKR Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9G7]

Sign In for Pricing
View Details
Human ZDHHC11 activation kit by CRISPRa
GA112672 1 Kit

Human ZDHHC11 activation kit by CRISPRa

Sign In for Pricing
View Details