Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-27, Mouse (HEK293, His, solution)

The IL-27 protein together with IL23A forms IL-23 interleukin, a key cytokine in innate and adaptive immunity. It is associated with infection responses, binds to IL12RB1 and IL23R receptor complexes, and activates Jak-Stat signaling. IL-27 Protein, Mouse (228a.a, HEK293, His, solution) is the recombinant mouse-derived IL-27, expressed by HEK293, with C-10*His labeled tag.

Product Specifications

Product Name Alternative

IL-27 Protein, Mouse (HEK293, His, solution), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-27-protein-mouse-228a-a-hek293-his-solution.html

Purity

95.00

Smiles

YTETALVALSQPRVQCHASRYPVAVDCSWTPLQAPNSTRSTSFIATYRLGVATQQQSQPCLQRSPQASRCTIPDVHLFSTVPYMLNVTAVHPGGASSSLLAFVAERIIKPDPPEGVRLRTAGQRLQVLWHPPASWPFPDIFSLKYRLRYRRRGASHFRQVGPIEATTFTLRNSKPHAKYCIQVSAQDLTDYGKPSDWSLPGQVESAPHKPGSGSGGSGGSGSGKLFPTDPLSLQELRREFTVSLYLARKLLSEVQGYVHSFAESRLPGVNLDLLPLGYHLPNVSLTFQAWHHLSDSERLCFLATTLRPFPAMLGGLGTQGTWTSSEREQLWAMRLDLRDLHRHLRFQVLAAGFKCSKEEEDKEEEEEEEEEEKKLPLGALGGPNQVSSQVSWPQLLYTYQLLHSLELVLSRAVRDLLLLSLPRRPGSAWDS

Molecular Formula

50498&246779 (Gene_ID) O35228 (Y19-P228) &GSGSGGSGGSGSGKL &Q8K3I6 (F29-S234) (Accession)

Molecular Weight

Approximately 60 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

anti-ICAM1 (6G12)
LF-MA30377 100 ul

anti-ICAM1 (6G12)

Sign In for Pricing
View Details
RPL21P79 AAV siRNA Pooled Vector
41085161 1.0 µg

RPL21P79 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
FastScan™ Phospho-4E-BP1 (Thr37/46) ELISA Kit
CST 49118V2 10 Kits

FastScan™ Phospho-4E-BP1 (Thr37/46) ELISA Kit

Sign In for Pricing
View Details
HEV ORF2 Protein
abx060577 100 µg

HEV ORF2 Protein

Sign In for Pricing
View Details
VAV1 (Vav 1 Guanine Nucleotide Exchange Factor, VAV) (MaxLight 405)
MBS6198607-01 0.1 mL

VAV1 (Vav 1 Guanine Nucleotide Exchange Factor, VAV) (MaxLight 405)

Sign In for Pricing
View Details
VAV1 (Vav 1 Guanine Nucleotide Exchange Factor, VAV) (MaxLight 405)
MBS6198607-02 5x 0.1 mL

VAV1 (Vav 1 Guanine Nucleotide Exchange Factor, VAV) (MaxLight 405)

Sign In for Pricing
View Details