Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cystatin-B (CSTB)

Product Specifications

Product Name Alternative

CPI-BLiver thiol proteinase inhibitorStefin-B

Abbreviation

Recombinant Human CSTB protein

Gene Name

CSTB

UniProt

P04080

Expression Region

1-98aa

Organism

Homo sapiens (Human)

Target Sequence

MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF

Tag

N-terminal GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

This is an intracellular thiol proteinase inhibitor. Tightly binding reversible inhibitor of cathepsins L, H and B.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

This is an intracellular thiol proteinase inhibitor. Tightly binding reversible inhibitor of cathepsins L, H and B.

Molecular Weight

38.1 kDa

References & Citations

Amino acid sequence of the intracellular cysteine proteinase inhibitor cystatin B from human liver.Ritonja A., Machleidt W., Barrett A.J.Biochem. Biophys. Res. Commun. 131:1187-1192 (1985)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Amino-2-chloro-N- (2-methoxyethyl) benzamide hydrochloride
GXB45861-01 250 mg

4-Amino-2-chloro-N- (2-methoxyethyl) benzamide hydrochloride

Sign In for Pricing
View Details
4-Amino-2-chloro-N- (2-methoxyethyl) benzamide hydrochloride
GXB45861-02 2.5 g

4-Amino-2-chloro-N- (2-methoxyethyl) benzamide hydrochloride

Sign In for Pricing
View Details
8-ArmPEG-MA, 10K
A88011-10K Inquire

8-ArmPEG-MA, 10K

Sign In for Pricing
View Details
Recombinant Neisseria Gonorrhoeae murG Protein (aa 1-355) (strain NCCP11945)
VAng-Wyb2667-200gEcoli 200 µg (E. coli)

Recombinant Neisseria Gonorrhoeae murG Protein (aa 1-355) (strain NCCP11945)

Sign In for Pricing
View Details
Bn2-PEG-OH, 20K
HE002171-20K Inquire

Bn2-PEG-OH, 20K

Sign In for Pricing
View Details
Rabbit Polyclonal Myosin Heavy Chain 3 Antibody [Alexa Fluor 405]
NBP2-81968AF405 0.1 mL

Rabbit Polyclonal Myosin Heavy Chain 3 Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details