Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD31/PECAM-1, Mouse (HEK293, His)

The CD31/PECAM-1 protein is a cell adhesion molecule critical for leukocyte transendothelial migration (TEM) under inflammatory conditions.CD31/PECAM-1 also regulates bradykinin receptor BDKRB2 activation and modulates ERK1/2 activation in endothelial cells.CD31/PECAM-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD31/PECAM-1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD31/PECAM-1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd31-pecam-1-protein-mouse-hek-293-his.html

Purity

95.0

Smiles

EENSFTINSIHMESLPSWEVMNGQQLTLECLVDISTTSKSRSQHRVLFYKDDAMVYNVTSREHTESYVIPQARVFHSGKYKCTVMLNNKEKTTIEYEVKVHGVSKPKVTLDKKEVTEGGVVTVNCSLQEEKPPIFFKIEKLEVGTKFVKRRIDKTSNENFVLMEFPIEAQDHVLVFRCQAGILSGFKLQESEPIRSEYVTVQESFSTPKFEIKPPGMIIEGDQLHIRCIVQVTHLVQEFTEIIIQKDKAIVATSKQSSEAVYSVMAMVEYSGHYTCKVESNRISKASSIMVNITELFPKPKLEFSSSRLDQGELLDLSCSVSGTPVANFTIQKEETVLSQYQNFSKIAEESDSGEYSCTAGIGKVVKRSGLVPIQVCEMLSKPSIFHDAKSEIIKGHAIGISCQSENGTAPITYHLMKAKSDFQTLEVTSNDPATFTDKPTRDMEYQCRADNCHSHPAVFSEILRVRVIAPVDEVVISILSSNEVQSGSEMVLRCSVKEGTSPITFQFYKEKEDRPFHQAVVNDTQAFWHNKQASKKQEGQYYCTASNRASSMRTSPRSSTLAVRVFLAPWKK

Molecular Formula

18613 (Gene_ID) Q08481 (E18-K590) (Accession)

Molecular Weight

Approximately 86-106 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Filricianine (sodium)
HY-159841A 1 Each

Filricianine (sodium)

Sign In for Pricing
View Details
2,3,5-Triphenyltetrazolium chloride, 99%
GC9514-250g 250 g

2,3,5-Triphenyltetrazolium chloride, 99%

Sign In for Pricing
View Details
DNA, ds (MaxLight 405)
MBS6244859-01 0.1 mL

DNA, ds (MaxLight 405)

Sign In for Pricing
View Details
DNA, ds (MaxLight 405)
MBS6244859-02 5x 0.1 mL

DNA, ds (MaxLight 405)

Sign In for Pricing
View Details
Recombinant Rat CBLN1 Protein, His (Fc)-Avi-tagged
CBLN1-814R 50 µg

Recombinant Rat CBLN1 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Tiquinamide HCl
MF-0111347-01 10 mg

Tiquinamide HCl

Sign In for Pricing
View Details