Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD31/PECAM-1, Mouse (HEK293, His)

The CD31/PECAM-1 protein is a cell adhesion molecule critical for leukocyte transendothelial migration (TEM) under inflammatory conditions.CD31/PECAM-1 also regulates bradykinin receptor BDKRB2 activation and modulates ERK1/2 activation in endothelial cells.CD31/PECAM-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD31/PECAM-1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD31/PECAM-1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd31-pecam-1-protein-mouse-hek-293-his.html

Purity

95.0

Smiles

EENSFTINSIHMESLPSWEVMNGQQLTLECLVDISTTSKSRSQHRVLFYKDDAMVYNVTSREHTESYVIPQARVFHSGKYKCTVMLNNKEKTTIEYEVKVHGVSKPKVTLDKKEVTEGGVVTVNCSLQEEKPPIFFKIEKLEVGTKFVKRRIDKTSNENFVLMEFPIEAQDHVLVFRCQAGILSGFKLQESEPIRSEYVTVQESFSTPKFEIKPPGMIIEGDQLHIRCIVQVTHLVQEFTEIIIQKDKAIVATSKQSSEAVYSVMAMVEYSGHYTCKVESNRISKASSIMVNITELFPKPKLEFSSSRLDQGELLDLSCSVSGTPVANFTIQKEETVLSQYQNFSKIAEESDSGEYSCTAGIGKVVKRSGLVPIQVCEMLSKPSIFHDAKSEIIKGHAIGISCQSENGTAPITYHLMKAKSDFQTLEVTSNDPATFTDKPTRDMEYQCRADNCHSHPAVFSEILRVRVIAPVDEVVISILSSNEVQSGSEMVLRCSVKEGTSPITFQFYKEKEDRPFHQAVVNDTQAFWHNKQASKKQEGQYYCTASNRASSMRTSPRSSTLAVRVFLAPWKK

Molecular Formula

18613 (Gene_ID) Q08481 (E18-K590) (Accession)

Molecular Weight

Approximately 86-106 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dvl2 (NM_007888) Mouse Untagged Clone
MC221150 10 µg

Dvl2 (NM_007888) Mouse Untagged Clone

Sign In for Pricing
View Details
Glutathione (FITC)
MBS6478256-01 0.1 mL

Glutathione (FITC)

Sign In for Pricing
View Details
Glutathione (FITC)
MBS6478256-02 5x 0.1 mL

Glutathione (FITC)

Sign In for Pricing
View Details
AQP0 Antibody
R32054 100 µg

AQP0 Antibody

Sign In for Pricing
View Details
NT5E Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV712914 1.0 µg DNA

NT5E Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
TNP2 Human shRNA Plasmid Kit (Locus ID 7142)
TR316762 1 Kit

TNP2 Human shRNA Plasmid Kit (Locus ID 7142)

Sign In for Pricing
View Details