Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD31/PECAM-1, Mouse (HEK293, His)

The CD31/PECAM-1 protein is a cell adhesion molecule critical for leukocyte transendothelial migration (TEM) under inflammatory conditions.CD31/PECAM-1 also regulates bradykinin receptor BDKRB2 activation and modulates ERK1/2 activation in endothelial cells.CD31/PECAM-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD31/PECAM-1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD31/PECAM-1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd31-pecam-1-protein-mouse-hek-293-his.html

Purity

95.0

Smiles

EENSFTINSIHMESLPSWEVMNGQQLTLECLVDISTTSKSRSQHRVLFYKDDAMVYNVTSREHTESYVIPQARVFHSGKYKCTVMLNNKEKTTIEYEVKVHGVSKPKVTLDKKEVTEGGVVTVNCSLQEEKPPIFFKIEKLEVGTKFVKRRIDKTSNENFVLMEFPIEAQDHVLVFRCQAGILSGFKLQESEPIRSEYVTVQESFSTPKFEIKPPGMIIEGDQLHIRCIVQVTHLVQEFTEIIIQKDKAIVATSKQSSEAVYSVMAMVEYSGHYTCKVESNRISKASSIMVNITELFPKPKLEFSSSRLDQGELLDLSCSVSGTPVANFTIQKEETVLSQYQNFSKIAEESDSGEYSCTAGIGKVVKRSGLVPIQVCEMLSKPSIFHDAKSEIIKGHAIGISCQSENGTAPITYHLMKAKSDFQTLEVTSNDPATFTDKPTRDMEYQCRADNCHSHPAVFSEILRVRVIAPVDEVVISILSSNEVQSGSEMVLRCSVKEGTSPITFQFYKEKEDRPFHQAVVNDTQAFWHNKQASKKQEGQYYCTASNRASSMRTSPRSSTLAVRVFLAPWKK

Molecular Formula

18613 (Gene_ID) Q08481 (E18-K590) (Accession)

Molecular Weight

Approximately 86-106 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS26P17 3'UTR GFP Stable Cell Line
TU072180 1.0 mL

RPS26P17 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Matched Pair - Total RNA - Human Primary and Metastatic Tumor Tissue: Lung
R8235152-PM-10 2x 10 µg

Matched Pair - Total RNA - Human Primary and Metastatic Tumor Tissue: Lung

Sign In for Pricing
View Details
FAM91A1 3'UTR Luciferase Stable Cell Line
TU007464 1.0 mL

FAM91A1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
TNNT1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2419805 3x 1.0 µg

TNNT1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Lentiviral human DHFR2 sgRNA gene knockout kit - Lentiviral human DHFR2 sgRNA gene knockout kit (plasmid)
GTR15356117 1 Vial

Lentiviral human DHFR2 sgRNA gene knockout kit - Lentiviral human DHFR2 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
LentimiRa-rno-miR-485-3p Vector
mr40859 500 ng

LentimiRa-rno-miR-485-3p Vector

Sign In for Pricing
View Details