Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD31/PECAM-1, Mouse (HEK293, His)

The CD31/PECAM-1 protein is a cell adhesion molecule critical for leukocyte transendothelial migration (TEM) under inflammatory conditions.CD31/PECAM-1 also regulates bradykinin receptor BDKRB2 activation and modulates ERK1/2 activation in endothelial cells.CD31/PECAM-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD31/PECAM-1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD31/PECAM-1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd31-pecam-1-protein-mouse-hek-293-his.html

Purity

95.0

Smiles

EENSFTINSIHMESLPSWEVMNGQQLTLECLVDISTTSKSRSQHRVLFYKDDAMVYNVTSREHTESYVIPQARVFHSGKYKCTVMLNNKEKTTIEYEVKVHGVSKPKVTLDKKEVTEGGVVTVNCSLQEEKPPIFFKIEKLEVGTKFVKRRIDKTSNENFVLMEFPIEAQDHVLVFRCQAGILSGFKLQESEPIRSEYVTVQESFSTPKFEIKPPGMIIEGDQLHIRCIVQVTHLVQEFTEIIIQKDKAIVATSKQSSEAVYSVMAMVEYSGHYTCKVESNRISKASSIMVNITELFPKPKLEFSSSRLDQGELLDLSCSVSGTPVANFTIQKEETVLSQYQNFSKIAEESDSGEYSCTAGIGKVVKRSGLVPIQVCEMLSKPSIFHDAKSEIIKGHAIGISCQSENGTAPITYHLMKAKSDFQTLEVTSNDPATFTDKPTRDMEYQCRADNCHSHPAVFSEILRVRVIAPVDEVVISILSSNEVQSGSEMVLRCSVKEGTSPITFQFYKEKEDRPFHQAVVNDTQAFWHNKQASKKQEGQYYCTASNRASSMRTSPRSSTLAVRVFLAPWKK

Molecular Formula

18613 (Gene_ID) Q08481 (E18-K590) (Accession)

Molecular Weight

Approximately 86-106 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

hsa-miR-4303 miRNA Antagomir
MBS8316959-01 10 nmol

hsa-miR-4303 miRNA Antagomir

Sign In for Pricing
View Details
hsa-miR-4303 miRNA Antagomir
MBS8316959-02 20 nmol

hsa-miR-4303 miRNA Antagomir

Sign In for Pricing
View Details
hsa-miR-4303 miRNA Antagomir
MBS8316959-03 5x 20 nmol

hsa-miR-4303 miRNA Antagomir

Sign In for Pricing
View Details
NT5DC1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3A6]
TA501566AM 100 µL

NT5DC1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3A6]

Sign In for Pricing
View Details
RNF207 Human Recombinant Protein
TP726169 50 µg

RNF207 Human Recombinant Protein

Sign In for Pricing
View Details
Rabbit Cytochrome P450 1A1 (CYP1A1) ELISA Kit
MBS7230203-01 48 Well

Rabbit Cytochrome P450 1A1 (CYP1A1) ELISA Kit

Sign In for Pricing
View Details