Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD31/PECAM-1, Mouse (HEK293, His)

The CD31/PECAM-1 protein is a cell adhesion molecule critical for leukocyte transendothelial migration (TEM) under inflammatory conditions.CD31/PECAM-1 also regulates bradykinin receptor BDKRB2 activation and modulates ERK1/2 activation in endothelial cells.CD31/PECAM-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD31/PECAM-1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD31/PECAM-1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd31-pecam-1-protein-mouse-hek-293-his.html

Purity

95.0

Smiles

EENSFTINSIHMESLPSWEVMNGQQLTLECLVDISTTSKSRSQHRVLFYKDDAMVYNVTSREHTESYVIPQARVFHSGKYKCTVMLNNKEKTTIEYEVKVHGVSKPKVTLDKKEVTEGGVVTVNCSLQEEKPPIFFKIEKLEVGTKFVKRRIDKTSNENFVLMEFPIEAQDHVLVFRCQAGILSGFKLQESEPIRSEYVTVQESFSTPKFEIKPPGMIIEGDQLHIRCIVQVTHLVQEFTEIIIQKDKAIVATSKQSSEAVYSVMAMVEYSGHYTCKVESNRISKASSIMVNITELFPKPKLEFSSSRLDQGELLDLSCSVSGTPVANFTIQKEETVLSQYQNFSKIAEESDSGEYSCTAGIGKVVKRSGLVPIQVCEMLSKPSIFHDAKSEIIKGHAIGISCQSENGTAPITYHLMKAKSDFQTLEVTSNDPATFTDKPTRDMEYQCRADNCHSHPAVFSEILRVRVIAPVDEVVISILSSNEVQSGSEMVLRCSVKEGTSPITFQFYKEKEDRPFHQAVVNDTQAFWHNKQASKKQEGQYYCTASNRASSMRTSPRSSTLAVRVFLAPWKK

Molecular Formula

18613 (Gene_ID) Q08481 (E18-K590) (Accession)

Molecular Weight

Approximately 86-106 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAD51AP2 ORF Vector (Human) (pORF)
ORF028672 1.0 µg DNA

RAD51AP2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
p-Coumaraldehyde
TRC-C755450-2.5G 2.5 g

p-Coumaraldehyde

Sign In for Pricing
View Details
Lentiviral human ASTL shRNA (UAS) - Lentiviral human ASTL shRNA (UAS, RFP) plasmid
GTR15124237 1 Vial

Lentiviral human ASTL shRNA (UAS) - Lentiviral human ASTL shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Anti-Cardiac Troponin I Rabbit pAb
GB11393-50 50 μL

Anti-Cardiac Troponin I Rabbit pAb

Sign In for Pricing
View Details
Siglec10 3'UTR Lenti-reporter-Luc Vector
43753086 1.0 µg

Siglec10 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Rat Interleukin 1 Receptor Antagonist (IL1RA) ELISA Kit
MBS451439-01 48 Tests

Rat Interleukin 1 Receptor Antagonist (IL1RA) ELISA Kit

Sign In for Pricing
View Details