Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD31/PECAM-1, Mouse (HEK293, His)

The CD31/PECAM-1 protein is a cell adhesion molecule critical for leukocyte transendothelial migration (TEM) under inflammatory conditions.CD31/PECAM-1 also regulates bradykinin receptor BDKRB2 activation and modulates ERK1/2 activation in endothelial cells.CD31/PECAM-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD31/PECAM-1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD31/PECAM-1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd31-pecam-1-protein-mouse-hek-293-his.html

Purity

95.0

Smiles

EENSFTINSIHMESLPSWEVMNGQQLTLECLVDISTTSKSRSQHRVLFYKDDAMVYNVTSREHTESYVIPQARVFHSGKYKCTVMLNNKEKTTIEYEVKVHGVSKPKVTLDKKEVTEGGVVTVNCSLQEEKPPIFFKIEKLEVGTKFVKRRIDKTSNENFVLMEFPIEAQDHVLVFRCQAGILSGFKLQESEPIRSEYVTVQESFSTPKFEIKPPGMIIEGDQLHIRCIVQVTHLVQEFTEIIIQKDKAIVATSKQSSEAVYSVMAMVEYSGHYTCKVESNRISKASSIMVNITELFPKPKLEFSSSRLDQGELLDLSCSVSGTPVANFTIQKEETVLSQYQNFSKIAEESDSGEYSCTAGIGKVVKRSGLVPIQVCEMLSKPSIFHDAKSEIIKGHAIGISCQSENGTAPITYHLMKAKSDFQTLEVTSNDPATFTDKPTRDMEYQCRADNCHSHPAVFSEILRVRVIAPVDEVVISILSSNEVQSGSEMVLRCSVKEGTSPITFQFYKEKEDRPFHQAVVNDTQAFWHNKQASKKQEGQYYCTASNRASSMRTSPRSSTLAVRVFLAPWKK

Molecular Formula

18613 (Gene_ID) Q08481 (E18-K590) (Accession)

Molecular Weight

Approximately 86-106 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human DCAF7 Recombinant Protein
PROTP61962-20ug 20 µg

Human DCAF7 Recombinant Protein

Sign In for Pricing
View Details
SPG5B sgRNA CRISPR Lentivector (Human) (Target 1)
K2271802 1.0 µg DNA

SPG5B sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Recombinant Clostridium novyi GTP cyclohydrolase 1 (folE)
MBS1053001-01 0.02 mg (E-Coli)

Recombinant Clostridium novyi GTP cyclohydrolase 1 (folE)

Sign In for Pricing
View Details
Recombinant Clostridium novyi GTP cyclohydrolase 1 (folE)
MBS1053001-02 0.1 mg (E-Coli)

Recombinant Clostridium novyi GTP cyclohydrolase 1 (folE)

Sign In for Pricing
View Details
Recombinant Clostridium novyi GTP cyclohydrolase 1 (folE)
MBS1053001-03 0.02 mg (Yeast)

Recombinant Clostridium novyi GTP cyclohydrolase 1 (folE)

Sign In for Pricing
View Details
Recombinant Clostridium novyi GTP cyclohydrolase 1 (folE)
MBS1053001-04 0.1 mg (Yeast)

Recombinant Clostridium novyi GTP cyclohydrolase 1 (folE)

Sign In for Pricing
View Details