Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD31/PECAM-1, Mouse (HEK293, His)

The CD31/PECAM-1 protein is a cell adhesion molecule critical for leukocyte transendothelial migration (TEM) under inflammatory conditions.CD31/PECAM-1 also regulates bradykinin receptor BDKRB2 activation and modulates ERK1/2 activation in endothelial cells.CD31/PECAM-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD31/PECAM-1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD31/PECAM-1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd31-pecam-1-protein-mouse-hek-293-his.html

Purity

95.0

Smiles

EENSFTINSIHMESLPSWEVMNGQQLTLECLVDISTTSKSRSQHRVLFYKDDAMVYNVTSREHTESYVIPQARVFHSGKYKCTVMLNNKEKTTIEYEVKVHGVSKPKVTLDKKEVTEGGVVTVNCSLQEEKPPIFFKIEKLEVGTKFVKRRIDKTSNENFVLMEFPIEAQDHVLVFRCQAGILSGFKLQESEPIRSEYVTVQESFSTPKFEIKPPGMIIEGDQLHIRCIVQVTHLVQEFTEIIIQKDKAIVATSKQSSEAVYSVMAMVEYSGHYTCKVESNRISKASSIMVNITELFPKPKLEFSSSRLDQGELLDLSCSVSGTPVANFTIQKEETVLSQYQNFSKIAEESDSGEYSCTAGIGKVVKRSGLVPIQVCEMLSKPSIFHDAKSEIIKGHAIGISCQSENGTAPITYHLMKAKSDFQTLEVTSNDPATFTDKPTRDMEYQCRADNCHSHPAVFSEILRVRVIAPVDEVVISILSSNEVQSGSEMVLRCSVKEGTSPITFQFYKEKEDRPFHQAVVNDTQAFWHNKQASKKQEGQYYCTASNRASSMRTSPRSSTLAVRVFLAPWKK

Molecular Formula

18613 (Gene_ID) Q08481 (E18-K590) (Accession)

Molecular Weight

Approximately 86-106 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Cytokeratin 16 (CK16) ELISA Kit
EKN46576 96 Tests

Human Cytokeratin 16 (CK16) ELISA Kit

Sign In for Pricing
View Details
Lentiviral human EARS2 shRNA (UAS) - Lentiviral human EARS2 shRNA (UAS) plasmid
GTR15158143 1 Vial

Lentiviral human EARS2 shRNA (UAS) - Lentiviral human EARS2 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Mouse Mthfd1 qPCR Primer Pair
QM50598S 200 Tests

Mouse Mthfd1 qPCR Primer Pair

Sign In for Pricing
View Details
MEPE (Matrix Extracellular PhosphoGlycoprotein) Sheep ELISA Kit
E9414 96 Tests

MEPE (Matrix Extracellular PhosphoGlycoprotein) Sheep ELISA Kit

Sign In for Pricing
View Details
Mouse Complement fragment C3a, C3a ELISA KIT
E0299Mo-01 48 Well

Mouse Complement fragment C3a, C3a ELISA KIT

Sign In for Pricing
View Details
Mouse Complement fragment C3a, C3a ELISA KIT
E0299Mo-02 96 Well

Mouse Complement fragment C3a, C3a ELISA KIT

Sign In for Pricing
View Details