Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD31/PECAM-1, Mouse (HEK293, His)

The CD31/PECAM-1 protein is a cell adhesion molecule critical for leukocyte transendothelial migration (TEM) under inflammatory conditions.CD31/PECAM-1 also regulates bradykinin receptor BDKRB2 activation and modulates ERK1/2 activation in endothelial cells.CD31/PECAM-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD31/PECAM-1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD31/PECAM-1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd31-pecam-1-protein-mouse-hek-293-his.html

Purity

95.0

Smiles

EENSFTINSIHMESLPSWEVMNGQQLTLECLVDISTTSKSRSQHRVLFYKDDAMVYNVTSREHTESYVIPQARVFHSGKYKCTVMLNNKEKTTIEYEVKVHGVSKPKVTLDKKEVTEGGVVTVNCSLQEEKPPIFFKIEKLEVGTKFVKRRIDKTSNENFVLMEFPIEAQDHVLVFRCQAGILSGFKLQESEPIRSEYVTVQESFSTPKFEIKPPGMIIEGDQLHIRCIVQVTHLVQEFTEIIIQKDKAIVATSKQSSEAVYSVMAMVEYSGHYTCKVESNRISKASSIMVNITELFPKPKLEFSSSRLDQGELLDLSCSVSGTPVANFTIQKEETVLSQYQNFSKIAEESDSGEYSCTAGIGKVVKRSGLVPIQVCEMLSKPSIFHDAKSEIIKGHAIGISCQSENGTAPITYHLMKAKSDFQTLEVTSNDPATFTDKPTRDMEYQCRADNCHSHPAVFSEILRVRVIAPVDEVVISILSSNEVQSGSEMVLRCSVKEGTSPITFQFYKEKEDRPFHQAVVNDTQAFWHNKQASKKQEGQYYCTASNRASSMRTSPRSSTLAVRVFLAPWKK

Molecular Formula

18613 (Gene_ID) Q08481 (E18-K590) (Accession)

Molecular Weight

Approximately 86-106 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHRNA3 Rabbit pAb
E45R23329N-100 100 µL

CHRNA3 Rabbit pAb

Sign In for Pricing
View Details
GP2, NT (GP2, Pancreatic secretory granule membrane major glycoprotein GP2, Pancreatic zymogen granule membrane protein GP-2, ZAP75) (AP) discontinued
036183-AP 200 µL

GP2, NT (GP2, Pancreatic secretory granule membrane major glycoprotein GP2, Pancreatic zymogen granule membrane protein GP-2, ZAP75) (AP) discontinued

Sign In for Pricing
View Details
Phosphoglycerate Mutase Activity Assay (C/F)
AKR-MA-0209 100 Well

Phosphoglycerate Mutase Activity Assay (C/F)

Sign In for Pricing
View Details
HPD (4-Hydroxyphenylpyruvate Dioxygenase, 4-hydroxyphenylpyruvic Acid Oxidase, 4HPPD, 4-HPPD, HPPDase, GLOD3, PPD) (HRP)
128056-HRP 100 µL

HPD (4-Hydroxyphenylpyruvate Dioxygenase, 4-hydroxyphenylpyruvic Acid Oxidase, 4HPPD, 4-HPPD, HPPDase, GLOD3, PPD) (HRP)

Sign In for Pricing
View Details
Human Immunodeficiency Virus Type 1 P24 Antigen (HIV-1 P24) ELISA Kit
JL19101-01 48 Tests

Human Immunodeficiency Virus Type 1 P24 Antigen (HIV-1 P24) ELISA Kit

Sign In for Pricing
View Details
Human Immunodeficiency Virus Type 1 P24 Antigen (HIV-1 P24) ELISA Kit
JL19101-02 96 Tests

Human Immunodeficiency Virus Type 1 P24 Antigen (HIV-1 P24) ELISA Kit

Sign In for Pricing
View Details