Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD31/PECAM-1, Mouse (HEK293, His)

The CD31/PECAM-1 protein is a cell adhesion molecule critical for leukocyte transendothelial migration (TEM) under inflammatory conditions.CD31/PECAM-1 also regulates bradykinin receptor BDKRB2 activation and modulates ERK1/2 activation in endothelial cells.CD31/PECAM-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD31/PECAM-1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD31/PECAM-1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd31-pecam-1-protein-mouse-hek-293-his.html

Purity

95.0

Smiles

EENSFTINSIHMESLPSWEVMNGQQLTLECLVDISTTSKSRSQHRVLFYKDDAMVYNVTSREHTESYVIPQARVFHSGKYKCTVMLNNKEKTTIEYEVKVHGVSKPKVTLDKKEVTEGGVVTVNCSLQEEKPPIFFKIEKLEVGTKFVKRRIDKTSNENFVLMEFPIEAQDHVLVFRCQAGILSGFKLQESEPIRSEYVTVQESFSTPKFEIKPPGMIIEGDQLHIRCIVQVTHLVQEFTEIIIQKDKAIVATSKQSSEAVYSVMAMVEYSGHYTCKVESNRISKASSIMVNITELFPKPKLEFSSSRLDQGELLDLSCSVSGTPVANFTIQKEETVLSQYQNFSKIAEESDSGEYSCTAGIGKVVKRSGLVPIQVCEMLSKPSIFHDAKSEIIKGHAIGISCQSENGTAPITYHLMKAKSDFQTLEVTSNDPATFTDKPTRDMEYQCRADNCHSHPAVFSEILRVRVIAPVDEVVISILSSNEVQSGSEMVLRCSVKEGTSPITFQFYKEKEDRPFHQAVVNDTQAFWHNKQASKKQEGQYYCTASNRASSMRTSPRSSTLAVRVFLAPWKK

Molecular Formula

18613 (Gene_ID) Q08481 (E18-K590) (Accession)

Molecular Weight

Approximately 86-106 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Retinoic Acid Receptor Alpha (RARa) Antibody
abx102932-01 100 µL

Retinoic Acid Receptor Alpha (RARa) Antibody

Sign In for Pricing
View Details
Retinoic Acid Receptor Alpha (RARa) Antibody
abx102932-02 200 µL

Retinoic Acid Receptor Alpha (RARa) Antibody

Sign In for Pricing
View Details
Retinoic Acid Receptor Alpha (RARa) Antibody
abx102932-03 1 mL

Retinoic Acid Receptor Alpha (RARa) Antibody

Sign In for Pricing
View Details
Sec8 (EXOC4) (NM_021807) Human 3' UTR Clone
SC213450 10 µg

Sec8 (EXOC4) (NM_021807) Human 3' UTR Clone

Sign In for Pricing
View Details
Tom1l2 ORF Vector (Mouse) (pORF)
ORF060171 1.0 µg DNA

Tom1l2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Rabbit Polyclonal ATPase Antibody [Alexa Fluor 647]
NBP2-98188AF647 0.1 mL

Rabbit Polyclonal ATPase Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details