Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TGFBR1/ALK-5, Human (HEK293, mFc-Avi)

TGFBR1/ALK-5 proteins cooperate with TGFBR2 to form dedicated receptors for TGFB1, TGFB2, and TGFB3, transmitting signals and coordinating different physiological and pathological processes. It induces cell cycle arrest, modulates mesenchymal cell dynamics, contributes to wound healing, and affects immunosuppression and carcinogenesis. TGFBR1/ALK-5 Protein, Human (HEK293, mFc-Avi) is the recombinant human-derived TGFBR1/ALK-5 protein, expressed by HEK293 , with C-Avi, C-mFc labeled tag.

Product Specifications

Product Name Alternative

TGFBR1/ALK-5 Protein, Human (HEK293, mFc-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tgfbr1-alk-5-protein-human-hek293-mfc-avi.html

Purity

95.0

Smiles

LQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPGLGPVE

Molecular Formula

7046 (Gene_ID) P36897-1 (L34-E125) (Accession)

Molecular Weight

50-60 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Beta-Ala-His dipeptidase,CNDP1 ELISA KIT
JOT-EK6545Hu-01 96 Well

Human Beta-Ala-His dipeptidase,CNDP1 ELISA KIT

Sign In for Pricing
View Details
Human Beta-Ala-His dipeptidase,CNDP1 ELISA KIT
JOT-EK6545Hu-02 48 Well

Human Beta-Ala-His dipeptidase,CNDP1 ELISA KIT

Sign In for Pricing
View Details
PATJ Rabbit pAb, PE-Cy7 conjugated
orb2825943 100 µL

PATJ Rabbit pAb, PE-Cy7 conjugated

Sign In for Pricing
View Details
Anti-Caspase-3 Antibody
11024-50-1 50 µg

Anti-Caspase-3 Antibody

Sign In for Pricing
View Details
EDEM3 Antibody - C-terminal region
ARP62508_P050-25UL 25 µL

EDEM3 Antibody - C-terminal region

Sign In for Pricing
View Details
Mmu-miR-3064-5p miRNA Inhibitor
orb1870219-01 10 nmol

Mmu-miR-3064-5p miRNA Inhibitor

Sign In for Pricing
View Details