Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNR2-VLP, Human (HEK293)

CNR2 Protein-VLP, Human (HEK293) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P702775. May have binding signals with Anti-His antibodies.

Product Specifications

Product Name Alternative

CNR2 Protein-VLP, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cnr2-protein-vlp-human-hek293.html

Purity

95.00

Smiles

MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC

Molecular Formula

1269 (Gene_ID) P34972 (M1-C360) (Accession)

Molecular Weight

Approximately 40.7 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kylt® Campylobacter jejuni, coli & lari FS 100
31449 each

Kylt® Campylobacter jejuni, coli & lari FS 100

Sign In for Pricing
View Details
Horse Pygopus Homolog 2 (PYGO2/PP7910) ELISA Kit
MBS9922799-01 48 Well

Horse Pygopus Homolog 2 (PYGO2/PP7910) ELISA Kit

Sign In for Pricing
View Details
Horse Pygopus Homolog 2 (PYGO2/PP7910) ELISA Kit
MBS9922799-02 96 Well

Horse Pygopus Homolog 2 (PYGO2/PP7910) ELISA Kit

Sign In for Pricing
View Details
Horse Pygopus Homolog 2 (PYGO2/PP7910) ELISA Kit
MBS9922799-03 5x 96 Well

Horse Pygopus Homolog 2 (PYGO2/PP7910) ELISA Kit

Sign In for Pricing
View Details
Horse Pygopus Homolog 2 (PYGO2/PP7910) ELISA Kit
MBS9922799-04 10x 96 Well

Horse Pygopus Homolog 2 (PYGO2/PP7910) ELISA Kit

Sign In for Pricing
View Details
Ntng2 Rat shRNA Plasmid (Locus ID 311836)
TL706374 1 Kit

Ntng2 Rat shRNA Plasmid (Locus ID 311836)

Sign In for Pricing
View Details