Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNR2-VLP, Human (HEK293)

CNR2 Protein-VLP, Human (HEK293) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P702775. May have binding signals with Anti-His antibodies.

Product Specifications

Product Name Alternative

CNR2 Protein-VLP, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cnr2-protein-vlp-human-hek293.html

Purity

95.00

Smiles

MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC

Molecular Formula

1269 (Gene_ID) P34972 (M1-C360) (Accession)

Molecular Weight

Approximately 40.7 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sodium L-lactate
GC8333-50g 50 g

Sodium L-lactate

Sign In for Pricing
View Details
PLCXD3 (PI-PLC X Domain-containing Protein 3)
131440 50 µg

PLCXD3 (PI-PLC X Domain-containing Protein 3)

Sign In for Pricing
View Details
Tissue, Section, Human Adult Normal, Gallbladder (Frozen)
MBS640592-01 5 Sections

Tissue, Section, Human Adult Normal, Gallbladder (Frozen)

Sign In for Pricing
View Details
Tissue, Section, Human Adult Normal, Gallbladder (Frozen)
MBS640592-02 5x 5 Sections

Tissue, Section, Human Adult Normal, Gallbladder (Frozen)

Sign In for Pricing
View Details
GFAP Monoclonal Antibody, AbBy Fluor™ 750 Conjugated
bsm-42001M-BF750 100 µL

GFAP Monoclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
MCPT1 siRNA (Rat)
CRR6912-01 15 nmol

MCPT1 siRNA (Rat)

Sign In for Pricing
View Details