Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNR2-VLP, Human (HEK293)

CNR2 Protein-VLP, Human (HEK293) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P702775. May have binding signals with Anti-His antibodies.

Product Specifications

Product Name Alternative

CNR2 Protein-VLP, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cnr2-protein-vlp-human-hek293.html

Purity

95.00

Smiles

MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC

Molecular Formula

1269 (Gene_ID) P34972 (M1-C360) (Accession)

Molecular Weight

Approximately 40.7 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

IKK alpha (CHUK) Rabbit Monoclonal Antibody [Clone ID: R07-9I7]
TA384000 100 µL

IKK alpha (CHUK) Rabbit Monoclonal Antibody [Clone ID: R07-9I7]

Sign In for Pricing
View Details
Cytl1 sgRNA CRISPR Lentivector (Rat) (Target 3)
K6149604 1.0 µg DNA

Cytl1 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
MRTO4 (C1orf33, MRT4) discontinued
511717 100 µg

MRTO4 (C1orf33, MRT4) discontinued

Sign In for Pricing
View Details
Lentiviral human SEC22A shRNA (UAS) - Lentiviral human SEC22A shRNA (UAS, iRFP) (25)
GTR15089630 1 Vial

Lentiviral human SEC22A shRNA (UAS) - Lentiviral human SEC22A shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
SLC30A2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2183507 1.0 µg DNA

SLC30A2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Neurogenin 2 Recombinant Antibody, AbBy Fluor™ 647 Conjugated
bsm-62177R-BF647 100 µL

Neurogenin 2 Recombinant Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details