Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNR2-VLP, Human (HEK293)

CNR2 Protein-VLP, Human (HEK293) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P702775. May have binding signals with Anti-His antibodies.

Product Specifications

Product Name Alternative

CNR2 Protein-VLP, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cnr2-protein-vlp-human-hek293.html

Purity

95.00

Smiles

MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC

Molecular Formula

1269 (Gene_ID) P34972 (M1-C360) (Accession)

Molecular Weight

Approximately 40.7 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ARH3 AssayLite™ Antibody (RPE Conjugate)
33462-05151 5x 30 µg

Human ARH3 AssayLite™ Antibody (RPE Conjugate)

Sign In for Pricing
View Details
IL-7 Protein, Bovine, Recombinant (His)
MF-0102741-01 5 µg

IL-7 Protein, Bovine, Recombinant (His)

Sign In for Pricing
View Details
IL-7 Protein, Bovine, Recombinant (His)
MF-0102741-02 10 µg

IL-7 Protein, Bovine, Recombinant (His)

Sign In for Pricing
View Details
IL-7 Protein, Bovine, Recombinant (His)
MF-0102741-03 20 µg

IL-7 Protein, Bovine, Recombinant (His)

Sign In for Pricing
View Details
IL-7 Protein, Bovine, Recombinant (His)
MF-0102741-04 50 µg

IL-7 Protein, Bovine, Recombinant (His)

Sign In for Pricing
View Details
IL-7 Protein, Bovine, Recombinant (His)
MF-0102741-05 100 µg

IL-7 Protein, Bovine, Recombinant (His)

Sign In for Pricing
View Details