Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNR2-VLP, Human (HEK293)

CNR2 Protein-VLP, Human (HEK293) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P702775. May have binding signals with Anti-His antibodies.

Product Specifications

Product Name Alternative

CNR2 Protein-VLP, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cnr2-protein-vlp-human-hek293.html

Purity

95.00

Smiles

MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC

Molecular Formula

1269 (Gene_ID) P34972 (M1-C360) (Accession)

Molecular Weight

Approximately 40.7 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBM27 Protein Vector (Human) (pPM-C-HA)
PV115052 500 ng

RBM27 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O6:K15:H31 (strain 536/UPEC) PYRF Polyclonal Antibody
MBS7189341 Inquire

Rabbit anti-Escherichia coli O6:K15:H31 (strain 536/UPEC) PYRF Polyclonal Antibody

Sign In for Pricing
View Details
Human Nucleolar Protein 8 (NOL8) ELISA Kit
QY-E03187 96 Tests

Human Nucleolar Protein 8 (NOL8) ELISA Kit

Sign In for Pricing
View Details
3-Acetyl-3-chlorodihydrofuranone
TRC-A172030-2.5G 2.5 g

3-Acetyl-3-chlorodihydrofuranone

Sign In for Pricing
View Details
ATL3, ID (ATL3, Atlastin-3) (AP)
MBS6276315-01 0.2 mL

ATL3, ID (ATL3, Atlastin-3) (AP)

Sign In for Pricing
View Details
ATL3, ID (ATL3, Atlastin-3) (AP)
MBS6276315-02 5x 0.2 mL

ATL3, ID (ATL3, Atlastin-3) (AP)

Sign In for Pricing
View Details