Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNR2-VLP, Human (HEK293)

CNR2 Protein-VLP, Human (HEK293) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P702775. May have binding signals with Anti-His antibodies.

Product Specifications

Product Name Alternative

CNR2 Protein-VLP, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cnr2-protein-vlp-human-hek293.html

Purity

95.00

Smiles

MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC

Molecular Formula

1269 (Gene_ID) P34972 (M1-C360) (Accession)

Molecular Weight

Approximately 40.7 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Palladin Antibody, mAb, Rabbit
A04181-100 100 µL

Palladin Antibody, mAb, Rabbit

Sign In for Pricing
View Details
Adenosine Triphosphate (ATP) Antibody
abx102087-01 100 µL

Adenosine Triphosphate (ATP) Antibody

Sign In for Pricing
View Details
Adenosine Triphosphate (ATP) Antibody
abx102087-02 200 µL

Adenosine Triphosphate (ATP) Antibody

Sign In for Pricing
View Details
Adenosine Triphosphate (ATP) Antibody
abx102087-03 1 mL

Adenosine Triphosphate (ATP) Antibody

Sign In for Pricing
View Details
CD59 Rabbit Monoclonal Antibody
TA422982 100 µL

CD59 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Dipslide Type SCN
DIP1014 10 / PCK

Dipslide Type SCN

Sign In for Pricing
View Details