Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNR2-VLP, Human (HEK293)

CNR2 Protein-VLP, Human (HEK293) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P702775. May have binding signals with Anti-His antibodies.

Product Specifications

Product Name Alternative

CNR2 Protein-VLP, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cnr2-protein-vlp-human-hek293.html

Purity

95.00

Smiles

MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC

Molecular Formula

1269 (Gene_ID) P34972 (M1-C360) (Accession)

Molecular Weight

Approximately 40.7 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RHEBL1 Human siRNA Oligo Duplex (Locus ID 121268)
SR314725 1 Kit

RHEBL1 Human siRNA Oligo Duplex (Locus ID 121268)

Sign In for Pricing
View Details
C-erbB2 (HER-2, neu Receptor) (BSA & Azide Free) (MaxLight 405) discontinued
C0026-11MX-ML405 100 µL

C-erbB2 (HER-2, neu Receptor) (BSA & Azide Free) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Human TAS1R1 shRNA Plasmid
abx962930-01 150 µg

Human TAS1R1 shRNA Plasmid

Sign In for Pricing
View Details
Human TAS1R1 shRNA Plasmid
abx962930-02 300 µg

Human TAS1R1 shRNA Plasmid

Sign In for Pricing
View Details
L-Glutamic acid g-tert-butyl ester a-amide hydrochloride
239262-01 250 mg

L-Glutamic acid g-tert-butyl ester a-amide hydrochloride

Sign In for Pricing
View Details
L-Glutamic acid g-tert-butyl ester a-amide hydrochloride
239262-02 1 g

L-Glutamic acid g-tert-butyl ester a-amide hydrochloride

Sign In for Pricing
View Details