Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNR2-VLP, Human (HEK293)

CNR2 Protein-VLP, Human (HEK293) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P702775. May have binding signals with Anti-His antibodies.

Product Specifications

Product Name Alternative

CNR2 Protein-VLP, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cnr2-protein-vlp-human-hek293.html

Purity

95.00

Smiles

MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC

Molecular Formula

1269 (Gene_ID) P34972 (M1-C360) (Accession)

Molecular Weight

Approximately 40.7 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 18 (Keratin 18) (Biotin)
228185 100 µg

Cytokeratin 18 (Keratin 18) (Biotin)

Sign In for Pricing
View Details
Monoclonal ARHGAP4 Antibody (monoclonal) (M01), Clone: 3F7
APR15016G 0.1mg

Monoclonal ARHGAP4 Antibody (monoclonal) (M01), Clone: 3F7

Sign In for Pricing
View Details
Cry2 3'UTR GFP Stable Cell Line
TU252820 1.0 mL

Cry2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Bovine Leukotriene B4 LT-B4 ELISA Kit
BG-BVN11472 1 Each

Bovine Leukotriene B4 LT-B4 ELISA Kit

Sign In for Pricing
View Details
CSNK2A2 (Casein Kinase 2, alpha Prime Polypeptide, CK2A2, CSNK2A1, FLJ43934) (MaxLight 750) discontinued
245016-ML750 100 µL

CSNK2A2 (Casein Kinase 2, alpha Prime Polypeptide, CK2A2, CSNK2A1, FLJ43934) (MaxLight 750) discontinued

Sign In for Pricing
View Details
SMC1 alpha Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-62981R-BF350-01 20 µL

SMC1 alpha Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details