Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNR2-VLP, Human (HEK293)

CNR2 Protein-VLP, Human (HEK293) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P702775. May have binding signals with Anti-His antibodies.

Product Specifications

Product Name Alternative

CNR2 Protein-VLP, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cnr2-protein-vlp-human-hek293.html

Purity

95.00

Smiles

MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC

Molecular Formula

1269 (Gene_ID) P34972 (M1-C360) (Accession)

Molecular Weight

Approximately 40.7 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc22a29 (NM_172776) Mouse Tagged ORF Clone Lentiviral Particle
MR224992L4V 200 µL

Slc22a29 (NM_172776) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
C1orf31 Protein Vector (Human) (pPB-N-His)
PV049786 500 ng

C1orf31 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Recombinant Bacillus pumilus DNA integrity scanning protein DisA (disA)
MBS1116678-01 0.02 mg (E-Coli)

Recombinant Bacillus pumilus DNA integrity scanning protein DisA (disA)

Sign In for Pricing
View Details
Recombinant Bacillus pumilus DNA integrity scanning protein DisA (disA)
MBS1116678-02 0.02 mg (Yeast)

Recombinant Bacillus pumilus DNA integrity scanning protein DisA (disA)

Sign In for Pricing
View Details
Recombinant Bacillus pumilus DNA integrity scanning protein DisA (disA)
MBS1116678-03 0.1 mg (E-Coli)

Recombinant Bacillus pumilus DNA integrity scanning protein DisA (disA)

Sign In for Pricing
View Details
Recombinant Bacillus pumilus DNA integrity scanning protein DisA (disA)
MBS1116678-04 0.1 mg (Yeast)

Recombinant Bacillus pumilus DNA integrity scanning protein DisA (disA)

Sign In for Pricing
View Details