Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNR2-VLP, Human (HEK293)

CNR2 Protein-VLP, Human (HEK293) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P702775. May have binding signals with Anti-His antibodies.

Product Specifications

Product Name Alternative

CNR2 Protein-VLP, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cnr2-protein-vlp-human-hek293.html

Purity

95.00

Smiles

MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC

Molecular Formula

1269 (Gene_ID) P34972 (M1-C360) (Accession)

Molecular Weight

Approximately 40.7 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal LAMP-2/CD107b Antibody (C9-9)
NBP2-66929 100 µL

Mouse Monoclonal LAMP-2/CD107b Antibody (C9-9)

Sign In for Pricing
View Details
Glutathione S Transferase Alpha 1 (GSTA1) Antibody
abx340021-01 100 µg

Glutathione S Transferase Alpha 1 (GSTA1) Antibody

Sign In for Pricing
View Details
Glutathione S Transferase Alpha 1 (GSTA1) Antibody
abx340021-02 1 mg

Glutathione S Transferase Alpha 1 (GSTA1) Antibody

Sign In for Pricing
View Details
CC2D2A Antibody
DF12884-01 100 µL

CC2D2A Antibody

Sign In for Pricing
View Details
CC2D2A Antibody
DF12884-02 200 µL

CC2D2A Antibody

Sign In for Pricing
View Details
SNORD116-28 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
44799111 3x 1.0 µg

SNORD116-28 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details