Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNR2-VLP, Human (HEK293)

CNR2 Protein-VLP, Human (HEK293) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P702775. May have binding signals with Anti-His antibodies.

Product Specifications

Product Name Alternative

CNR2 Protein-VLP, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cnr2-protein-vlp-human-hek293.html

Purity

95.00

Smiles

MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC

Molecular Formula

1269 (Gene_ID) P34972 (M1-C360) (Accession)

Molecular Weight

Approximately 40.7 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

AP-1 Polyclonal Antibody
MBS9242720-01 0.1 mL

AP-1 Polyclonal Antibody

Sign In for Pricing
View Details
AP-1 Polyclonal Antibody
MBS9242720-02 5x 0.1 mL

AP-1 Polyclonal Antibody

Sign In for Pricing
View Details
PRMT7 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
37721124 3x 1.0µg DNA

PRMT7 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
TAS2R31, CT (TAS2R31, TAS2R44, Taste receptor type 2 member 31, Taste receptor type 2 member 44, Taste receptor type 2 member 53) (MaxLight 650)
MBS6353707-01 0.1 mL

TAS2R31, CT (TAS2R31, TAS2R44, Taste receptor type 2 member 31, Taste receptor type 2 member 44, Taste receptor type 2 member 53) (MaxLight 650)

Sign In for Pricing
View Details
TAS2R31, CT (TAS2R31, TAS2R44, Taste receptor type 2 member 31, Taste receptor type 2 member 44, Taste receptor type 2 member 53) (MaxLight 650)
MBS6353707-02 5x 0.1 mL

TAS2R31, CT (TAS2R31, TAS2R44, Taste receptor type 2 member 31, Taste receptor type 2 member 44, Taste receptor type 2 member 53) (MaxLight 650)

Sign In for Pricing
View Details
NAT1 (NM_001160172) Human Tagged ORF Clone
RC228810 10 µg

NAT1 (NM_001160172) Human Tagged ORF Clone

Sign In for Pricing
View Details