Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNR2-VLP, Human (HEK293)

CNR2 Protein-VLP, Human (HEK293) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P702775. May have binding signals with Anti-His antibodies.

Product Specifications

Product Name Alternative

CNR2 Protein-VLP, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cnr2-protein-vlp-human-hek293.html

Purity

95.00

Smiles

MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC

Molecular Formula

1269 (Gene_ID) P34972 (M1-C360) (Accession)

Molecular Weight

Approximately 40.7 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Cytokeratin 17 Antibody (KRT17/4604) [Alexa Fluor 488]
NBP3-08541AF488 100 µL

Mouse Monoclonal Cytokeratin 17 Antibody (KRT17/4604) [Alexa Fluor 488]

Sign In for Pricing
View Details
Olr376 Rat shRNA Lentiviral Particle (Locus ID 293809)
TL700092V 500 µL Each

Olr376 Rat shRNA Lentiviral Particle (Locus ID 293809)

Sign In for Pricing
View Details
Diatrizoic acid (Amidotrizoic Acid) discontinued. see 237309
D3472 50 g

Diatrizoic acid (Amidotrizoic Acid) discontinued. see 237309

Sign In for Pricing
View Details
ZIC3 Rabbit Polyclonal Antibody (Center)
E28PB2108 100 µL

ZIC3 Rabbit Polyclonal Antibody (Center)

Sign In for Pricing
View Details
RPL27A (NM_000990) Human Tagged ORF Clone Lentiviral Particle
RC213110L4V 200 µL

RPL27A (NM_000990) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Citracidone Ⅰ
TBZ1162 unit

Citracidone Ⅰ

Sign In for Pricing
View Details