Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNR2-VLP, Human (HEK293)

CNR2 Protein-VLP, Human (HEK293) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P702775. May have binding signals with Anti-His antibodies.

Product Specifications

Product Name Alternative

CNR2 Protein-VLP, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cnr2-protein-vlp-human-hek293.html

Purity

95.00

Smiles

MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC

Molecular Formula

1269 (Gene_ID) P34972 (M1-C360) (Accession)

Molecular Weight

Approximately 40.7 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Annexin VII (ANXA7) (NM_004034) Human Mass Spec Standard
PH321723 10 µg

Annexin VII (ANXA7) (NM_004034) Human Mass Spec Standard

Sign In for Pricing
View Details
Tmem163 (NM_028135) Mouse Tagged ORF Clone
MR203920 10 µg

Tmem163 (NM_028135) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
NCX1, ID (Na+/Ca2+ Exchange Protein 1, CNC, DKFZp779F0871, MGC119581, Na+/Ca2+ Exchanger, NCX, Solute Carrier Family 8 Member 1, SLC8A1)
N0560-21B 200 µL

NCX1, ID (Na+/Ca2+ Exchange Protein 1, CNC, DKFZp779F0871, MGC119581, Na+/Ca2+ Exchanger, NCX, Solute Carrier Family 8 Member 1, SLC8A1)

Sign In for Pricing
View Details
RN5S189 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV743915 1.0 µg DNA

RN5S189 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Inhibitor hsa-miR-431-3p AAV miRNA Vector
Amh3081100 500 ng

Inhibitor hsa-miR-431-3p AAV miRNA Vector

Sign In for Pricing
View Details
LOC685157 Rat siRNA Oligo Duplex (Locus ID 685157)
SR514455 1 Kit

LOC685157 Rat siRNA Oligo Duplex (Locus ID 685157)

Sign In for Pricing
View Details