Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNR2-VLP, Human (HEK293)

CNR2 Protein-VLP, Human (HEK293) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P702775. May have binding signals with Anti-His antibodies.

Product Specifications

Product Name Alternative

CNR2 Protein-VLP, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cnr2-protein-vlp-human-hek293.html

Purity

95.00

Smiles

MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC

Molecular Formula

1269 (Gene_ID) P34972 (M1-C360) (Accession)

Molecular Weight

Approximately 40.7 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Claudin 5 Peptide
AF6935-BP 1 mg

Claudin 5 Peptide

Sign In for Pricing
View Details
Rabbit Polyclonal SPANXN4 Antibody [DyLight 650]
NBP2-98021C 0.1 mL

Rabbit Polyclonal SPANXN4 Antibody [DyLight 650]

Sign In for Pricing
View Details
Rabbit Monoclonal PRMT1 Antibody (10W10U4)
NBP3-16423-100ul 100 µL

Rabbit Monoclonal PRMT1 Antibody (10W10U4)

Sign In for Pricing
View Details
MAGEA6 sgRNA CRISPR Lentivector (Human) (Target 3)
K1253904 1.0 µg DNA

MAGEA6 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Anti-E2F7 antibody
STJ71884 100 µg

Anti-E2F7 antibody

Sign In for Pricing
View Details
TMED1 (NM_006858) Human Over-expression Lysate
LC402049 20 µg

TMED1 (NM_006858) Human Over-expression Lysate

Sign In for Pricing
View Details