Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMGN3, Human (His)

HMGN3 binds to nucleosomes, regulates chromatin structure, and affects chromatin-dependent processes such as transcription and DNA repair. It affects insulin and glucagon levels and regulates pancreatic gene expression related to insulin secretion. HMGN3 Protein, Human (His) is the recombinant human-derived HMGN3 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

HMGN3 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hmgn3-protein-human-his.html

Purity

98.0

Smiles

MPKRKSPENTEGKDGSKVTKQEPTRRSARLSAKPAPPKPEPKPRKTSAKKEPGAKISRGAKGKKEEKQEAGKEGTEN

Molecular Formula

9324 (Gene_ID) Q15651-2 (M1-N77) (Accession)

Molecular Weight

Approximately 17 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Defb3 AAV siRNA Pooled Vector
17976166 1.0 µg

Defb3 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Zfp820 Mouse qPCR Primer Pair (NM_029281)
MP218995 200 Reactions

Zfp820 Mouse qPCR Primer Pair (NM_029281)

Sign In for Pricing
View Details
Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (BCL2/2210R), CF647 conjugate, 0.1mg/mL
BNC472210-500 1x 500 µL

Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (BCL2/2210R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NDUFB9 Antibody (HRP)
orb400781-01 50 µg

NDUFB9 Antibody (HRP)

Sign In for Pricing
View Details
NDUFB9 Antibody (HRP)
orb400781-02 100 µg

NDUFB9 Antibody (HRP)

Sign In for Pricing
View Details
BCL2A1 Recombinant Antibody, AbBy Fluor™ 750 Conjugated
bsm-52023R-BF750-01 20 µL

BCL2A1 Recombinant Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details