Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLIC4/Chloride intracellular channel 4, Human (His)

CLIC4/Chloride The intracellular channel 4 protein inserts into the membrane to form a pH-dependent, poorly selective ion channel that transports chloride ions.It enhances cell surface expression of HRH3 and maintains membrane polarity during angiogenesis, mitosis, cytokinesis, endothelial cell proliferation, and morphogenesis.CLIC4/Chloride intracellular channel 4 Protein, Human (His) is the recombinant human-derived CLIC4/Chloride intracellular channel 4 protein, expressed by E.coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

CLIC4/Chloride intracellular channel 4 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/chloride-intracellular-channel-protein-4-clic4-protein-human-his.html

Smiles

MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK

Molecular Formula

25932 (Gene_ID) Q9Y696 (M1-K253) (Accession)

Molecular Weight

Approximately 32 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog