Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCP-1/CCL2, Mouse (HEK293)

MCP-1/CCL2 Protein, Mouse (HEK293) is a cytokine belonging to the CC chemokine family that interacts with the CCR2 chemokine receptor on the cell surface to mediate inflammatory immune responses, viral infections, and tumorigenesis. MCP-1/CCL2 Protein, Mouse (HEK293) is a mouse MCP-1/CCL2 (Q24-R96) expressed by HEK293[1].

Product Specifications

Product Name Alternative

MCP-1/CCL2 Protein, Mouse (HEK293), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mcp-1-ccl2-protein-mouse-hek293.html

Purity

96.07

Smiles

QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMR

Molecular Formula

20296 (Gene_ID) P10148 (Q24-R96) (Accession)

Molecular Weight

Approximately 9 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Qiongyu Hao, et al. CCL2/CCR2 signaling in cancer pathogenesis. Cell Commun Signal. 2020 May 29;18 (1) :82.|[2]Svetlana M Stamatovic, et al. Monocyte chemoattractant protein-1 regulation of blood-brain barrier permeability. J Cereb Blood Flow Metab. 2005 May;25 (5) :593-606.|[3]Rachel N Gomes, et al. Bacterial clearance in septic mice is modulated by MCP-1/CCL2 and nitric oxide. Shock. 2013 Jan;39 (1) :63-9.|[4]Lijun Zhang, et al. Effect of chemokine CC ligand 2 (CCL2) on α?synuclein?induced microglia proliferation and neuronal apoptosis. Mol Med Rep. 2018 Nov;18 (5) :4213-4218.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4930407I10Rik Protein Vector (Mouse) (pPM-C-HA)
PV149028 500 ng

4930407I10Rik Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Lentiviral human LUM shRNA (UAS) - Lentiviral human LUM shRNA (UAS, RFP) plasmid
GTR15131677 1 Vial

Lentiviral human LUM shRNA (UAS) - Lentiviral human LUM shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
ATP10D (NM_020453) Human Tagged Lenti ORF Clone
RC221370L3 10 µg

ATP10D (NM_020453) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CK10/Cytokeratin 10 Recombinant Antibody, AbBy Fluor™ 488 Conjugated
bsm-52052R-BF488-TR 20 µL

CK10/Cytokeratin 10 Recombinant Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Recombinant Doublecortin Like Kinase 3 (DCLK3)
MBS2123447-01 0.01 mg

Recombinant Doublecortin Like Kinase 3 (DCLK3)

Sign In for Pricing
View Details
Recombinant Doublecortin Like Kinase 3 (DCLK3)
MBS2123447-02 0.05 mg

Recombinant Doublecortin Like Kinase 3 (DCLK3)

Sign In for Pricing
View Details