Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCP-1/CCL2, Mouse (HEK293)

MCP-1/CCL2 Protein, Mouse (HEK293) is a cytokine belonging to the CC chemokine family that interacts with the CCR2 chemokine receptor on the cell surface to mediate inflammatory immune responses, viral infections, and tumorigenesis. MCP-1/CCL2 Protein, Mouse (HEK293) is a mouse MCP-1/CCL2 (Q24-R96) expressed by HEK293[1].

Product Specifications

Product Name Alternative

MCP-1/CCL2 Protein, Mouse (HEK293), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mcp-1-ccl2-protein-mouse-hek293.html

Purity

96.07

Smiles

QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMR

Molecular Formula

20296 (Gene_ID) P10148 (Q24-R96) (Accession)

Molecular Weight

Approximately 9 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Qiongyu Hao, et al. CCL2/CCR2 signaling in cancer pathogenesis. Cell Commun Signal. 2020 May 29;18 (1) :82.|[2]Svetlana M Stamatovic, et al. Monocyte chemoattractant protein-1 regulation of blood-brain barrier permeability. J Cereb Blood Flow Metab. 2005 May;25 (5) :593-606.|[3]Rachel N Gomes, et al. Bacterial clearance in septic mice is modulated by MCP-1/CCL2 and nitric oxide. Shock. 2013 Jan;39 (1) :63-9.|[4]Lijun Zhang, et al. Effect of chemokine CC ligand 2 (CCL2) on α?synuclein?induced microglia proliferation and neuronal apoptosis. Mol Med Rep. 2018 Nov;18 (5) :4213-4218.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFluor® 450 Anti-human CD4 Antibody *SK3*
10042040-AAT 100 Tests

IFluor® 450 Anti-human CD4 Antibody *SK3*

Sign In for Pricing
View Details
CCDC122 (NM_144974) Human Untagged Clone
SC312801 10 µg

CCDC122 (NM_144974) Human Untagged Clone

Sign In for Pricing
View Details
Mouse Monoclonal Geminin Antibody (2H7) [Alexa Fluor 594]
NBP1-04293AF594 0.1 mL

Mouse Monoclonal Geminin Antibody (2H7) [Alexa Fluor 594]

Sign In for Pricing
View Details
Human DMBT1 (Deleted in malignant brain tumors 1 protein) QuickTest ELISA Kit
MBS7619879-01 48 Well

Human DMBT1 (Deleted in malignant brain tumors 1 protein) QuickTest ELISA Kit

Sign In for Pricing
View Details
Human DMBT1 (Deleted in malignant brain tumors 1 protein) QuickTest ELISA Kit
MBS7619879-02 96 Well

Human DMBT1 (Deleted in malignant brain tumors 1 protein) QuickTest ELISA Kit

Sign In for Pricing
View Details
Human DMBT1 (Deleted in malignant brain tumors 1 protein) QuickTest ELISA Kit
MBS7619879-03 5x 96 Well

Human DMBT1 (Deleted in malignant brain tumors 1 protein) QuickTest ELISA Kit

Sign In for Pricing
View Details